HHsearch alignment for GI: 254780240 and conserved domain: COG1102

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism].
Probab=99.53  E-value=3.5e-13  Score=103.33  Aligned_cols=168  Identities=21%  Similarity=0.217  Sum_probs=101.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHH-HH---HHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             96999878899967899999997189489578999999960-01---456666776413445541035665554202322
Q gi|254780240|r    1 MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDR-NT---LLGKQVKGSMESGSLISDAIVNQVVCDRIRLPD   76 (201)
Q Consensus         1 m~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~-~s---~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~   76 (201)
T Consensus         1 m~ItIsG~pGsG~TTva~~lAe~~gl~~vsaG~iFR~~A~e~gmsl~ef~~~AE~~-------p--~iD~~iD~rq~e~a   71 (179)
T COG1102           1 MVITISGLPGSGKTTVARELAEHLGLKLVSAGTIFREMARERGMSLEEFSRYAEED-------P--EIDKEIDRRQKELA   71 (179)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHCCCEEECCHHHHHHHHHCCCCHHHHHHHHHCC-------C--HHHHHHHHHHHHHH
T ss_conf             97996179999702799999998297156212799999998399999999987519-------2--16699889999998


Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC---CCCCCCCCCCHHHHHHHHHH
Q ss_conf             253178638011124578887666531252221035554221256642331123233---34556567898999999999
Q gi|254780240|r   77 CDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIA---SEKSVRSDDKYDVFLKRIEN  153 (201)
Q Consensus        77 ~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~---~~~~~R~DD~~e~i~~Rl~~  153 (201)
T Consensus        72 ~~~nvVleg---------rLA~Wi~k--~~adlkI~L~Apl~vRa~Ria~REgi~~~~a~~~~~~----RE~se~kRY~~  136 (179)
T COG1102          72 KEGNVVLEG---------RLAGWIVR--EYADLKIWLKAPLEVRAERIAKREGIDVDEALAETVE----REESEKKRYKK  136 (179)
T ss_pred             HCCCEEEHH---------HHHHHHHC--CCCCEEEEEECCHHHHHHHHHHHCCCCHHHHHHHHHH----HHHHHHHHHHH
T ss_conf             728958700---------45788733--5654688885759999999998608989999999999----88999999999


Q ss_pred             HHHHHHHHHHHHHHCCC-EEEECCCC-CHHHHHHHHHHHHHHHHHHH
Q ss_conf             99975699999996797-99993899-88999999999999999876
Q gi|254780240|r  154 YRKTILPLSSYYRDMGC-LYIIDGML-DMDEVSRSIDSLLVSVRKKC  198 (201)
Q Consensus       154 y~~~~~pv~~~y~~~~~-l~~Idg~~-~~~eV~~~I~~~l~~~~k~~  198 (201)
T Consensus       137 ~Yg-----IDi-dDlSiyDLVinTs~~~~~~v~~il~~aid~~~~~~  177 (179)
T COG1102         137 IYG-----IDI-DDLSIYDLVINTSKWDPEEVFLILLDAIDALSIKE  177 (179)
T ss_pred             HHC-----CCC-CCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             858-----787-66636778875366788899999999987421346