HHsearch alignment for GI: 254780240 and conserved domain: COG1428

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism].
Probab=98.65  E-value=8.2e-08  Score=69.71  Aligned_cols=116  Identities=20%  Similarity=0.174  Sum_probs=59.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEECH----HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCC--
Q ss_conf             9699987889996789999999718948957----8999999960014566667764134455410356655542023--
Q gi|254780240|r    1 MRIIFLGPPGSGKGTQACRLSQKLNVPQLST----GDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRL--   74 (201)
Q Consensus         1 m~I~i~G~PGsGK~T~a~~la~~~~~~~is~----gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~--   74 (201)
T Consensus         5 ~~IvI~G~IG~GKSTLa~~La~~l~~~~~~E~vednp~L~~FY~d~~~yaf~~Q--------------iyFL~~Rfk~~k   70 (216)
T COG1428           5 MVIVIEGMIGAGKSTLAQALAEHLGFKVFYELVEDNPFLDLFYEDPERYAFLLQ--------------IYFLLNRFKKIK   70 (216)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHH
T ss_conf             089984464468789999999883885022224678479999876997419999--------------999999999999


Q ss_pred             CCCCC-EEEEC------C-CHH-------HH--HHHH----HHHH---HHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             22253-17863------8-011-------12--4578----8876---66531252221035554221256642331123
Q gi|254780240|r   75 PDCDS-GFILD------G-YPR-------TV--DQAK----SLHA---FISNMDCAIDAVIELRVEDASMFKRIQVRVLE  130 (201)
Q Consensus        75 ~~~~~-g~ilD------G-FPR-------t~--~Qa~----~l~~---~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~  130 (201)
T Consensus        71 ~~~~~~~~i~drsI~eD~~lf~~~~~~~g~~~~~e~~~Y~~L~~~~~~~l~~~p~~PdllIyLd~~~e~~l~RI~~RgR~  150 (216)
T COG1428          71 KALSDKNNILDRSIFEDYFLFAKLNFAKGTLSPSEFKYYDDLYDNMLEELPYLPGRPDLLIYLDASLETLLRRIAKRGRP  150 (216)
T ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHCCC
T ss_conf             98431555458543425788999899847888889999999998799873257899988999827899999999981997