HHsearch alignment for GI: 254780240 and conserved domain: COG2074

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism].
Probab=98.13  E-value=0.00015  Score=49.34  Aligned_cols=165  Identities=24%  Similarity=0.340  Sum_probs=80.6

Q ss_pred             EEEE-CCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHH-H-HH-----------HHH----------HHHHHHCCCC
Q ss_conf             9998-788999678999999971894895789999999600-1-45-----------666----------6776413445
Q gi|254780240|r    3 IIFL-GPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRN-T-LL-----------GKQ----------VKGSMESGSL   58 (201)
Q Consensus         3 I~i~-G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~-s-~~-----------g~~----------i~~~l~~G~l   58 (201)
T Consensus        91 IILIGGasGVGkStIA~ElA~rLgI~~visTD~IREvlR~ii~~~l~PtLh~Ssy~Awkalr~~~~~~piiaGF~dqa~~  170 (299)
T COG2074          91 IILIGGASGVGKSTIAGELARRLGIRSVISTDSIREVLRKIISPELLPTLHTSSYDAWKALRDPTDENPIIAGFEDQASA  170 (299)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCCEEECCHHHHHHHHHHCCHHHCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             99961788777257999999972986100424799999973797745535675779999836899996131317877679


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCEEEECCC---HHHHHHHHHHHHHHHHHCCCCCCHHHHHH-HHHHHHHHHHHHCCCCCCC
Q ss_conf             5410356655542023222531786380---11124578887666531252221035554-2212566423311232333
Q gi|254780240|r   59 ISDAIVNQVVCDRIRLPDCDSGFILDGY---PRTVDQAKSLHAFISNMDCAIDAVIELRV-EDASMFKRIQVRVLEAIAS  134 (201)
Q Consensus        59 vpd~ii~~li~~~l~~~~~~~g~ilDGF---PRt~~Qa~~l~~~l~~~~~~~~~vi~L~~-~~~~~~~R~~~R~~~~~~~  134 (201)
T Consensus       171 V~~G-I~~VI~RAi~e---G~~lIIEGvHlVPg~i~~~-----~~-~---~n~~~~~l~i~dee~Hr~RF~~R~~~t~~~  237 (299)
T COG2074         171 VMVG-IEAVIERAIEE---GEDLIIEGVHLVPGLIKEE-----AL-G---NNVFMFMLYIADEELHRERFYDRIRYTHAS  237 (299)
T ss_pred             HHHH-HHHHHHHHHHC---CCCEEEEEEEECCCCCCHH-----HH-C---CCEEEEEEEECCHHHHHHHHHHHHHHHHCC
T ss_conf             9988-99999999853---7535887421150021676-----61-3---551789998388789999999988887605


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH----HHCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             4556567898999999999999756999999----9679799993899889999999999999
Q gi|254780240|r  135 EKSVRSDDKYDVFLKRIENYRKTILPLSSYY----RDMGCLYIIDGMLDMDEVSRSIDSLLVS  193 (201)
Q Consensus       135 ~~~~R~DD~~e~i~~Rl~~y~~~~~pv~~~y----~~~~~l~~Idg~~~~~eV~~~I~~~l~~  193 (201)
T Consensus       238 ----rp-------~~Ryl~yf~EiR~I~Dyl~~~Are~g-VPvI~n~-di~etv~~il~~i~~  287 (299)
T COG2074         238 ----RP-------GGRYLEYFKEIRTIHDYLVERAREHG-VPVIEND-DIDETVDRILEDIRK  287 (299)
T ss_pred             ----CC-------HHHHHHHHHHHHHHHHHHHHHHHHCC-CCEECCC-CHHHHHHHHHHHHHH
T ss_conf             ----96-------56799999999999999999888659-9811253-199999999999999