HHsearch alignment for GI: 254780240 and conserved domain: COG2274

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms].
Probab=94.80  E-value=0.023  Score=35.59  Aligned_cols=65  Identities=20%  Similarity=0.294  Sum_probs=36.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC------------CEECHHHHHHHHH----HHHHHHHHHHHHHHHCCCCC-CCHHH
Q ss_conf             6999878899967899999997189------------4895789999999----60014566667764134455-41035
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKLNV------------PQLSTGDMLRAEV----DRNTLLGKQVKGSMESGSLI-SDAIV   64 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~~~------------~~is~gdllR~~~----~~~s~~g~~i~~~l~~G~lv-pd~ii   64 (201)
T Consensus       501 ~vaIvG~SGsGKSTL~KLL~gly~p~~G~I~~dg~dl~~i~~~-~lR~~ig~V~Q~~~Lf~gSI~eNi~l~~p~~~~e~i  579 (709)
T COG2274         501 KVAIVGRSGSGKSTLLKLLLGLYKPQQGRILLDGVDLNDIDLA-SLRRQVGYVLQDPFLFSGSIRENIALGNPEATDEEI  579 (709)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEEHHHCCHH-HHHHHEEEECCCCHHHCCCHHHHHHCCCCCCCHHHH
T ss_conf             8999879999889999998367888885599998727866999-998654687466532047398797468999997999


Q ss_pred             HHH
Q ss_conf             665
Q gi|254780240|r   65 NQV   67 (201)
Q Consensus        65 ~~l   67 (201)
T Consensus       580 ~~A  582 (709)
T COG2274         580 IEA  582 (709)
T ss_pred             HHH
T ss_conf             999