HHsearch alignment for GI: 254780240 and conserved domain: COG2812

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair].
Probab=96.79  E-value=0.0048  Score=39.80  Aligned_cols=106  Identities=17%  Similarity=0.291  Sum_probs=53.3

Q ss_pred             EEECCCCCCHHHHHHHHHHHHCCCEECHHHHH-----HHHHHHHHHH-HHHHHHHHHCCCCCCCHHHHHHHHHHHCCCC-
Q ss_conf             99878899967899999997189489578999-----9999600145-6666776413445541035665554202322-
Q gi|254780240|r    4 IFLGPPGSGKGTQACRLSQKLNVPQLSTGDML-----RAEVDRNTLL-GKQVKGSMESGSLISDAIVNQVVCDRIRLPD-   76 (201)
Q Consensus         4 ~i~G~PGsGK~T~a~~la~~~~~~~is~gdll-----R~~~~~~s~~-g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~-   76 (201)
T Consensus        42 lfsG~RGvGKTt~Ari~AkalNC~~~~~~ePC~~C~~Ck~I~~g~~~DviEiDaASn~----gVddiR~i~-e~v~y~P~  116 (515)
T COG2812          42 LFSGPRGVGKTTIARILAKALNCENGPTAEPCGKCISCKEINEGSLIDVIEIDAASNT----GVDDIREII-EKVNYAPS  116 (515)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHCC----CHHHHHHHH-HHHCCCCC
T ss_conf             5137777671049999999956889877772253166686514886410113644454----867999999-87246886


Q ss_pred             -C-CCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             -2-531786380111245788876665312522210355542
Q gi|254780240|r   77 -C-DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVE  116 (201)
Q Consensus        77 -~-~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~  116 (201)
T Consensus       117 ~~ryKVyiIDEv--HMLS~~afNALLKTLEEPP~hV~FIlAT  156 (515)
T COG2812         117 EGRYKVYIIDEV--HMLSKQAFNALLKTLEEPPSHVKFILAT  156 (515)
T ss_pred             CCCCEEEEEECH--HHHHHHHHHHHHCCCCCCCCCEEEEEEC
T ss_conf             666418998318--7643788888751113686674899853