HHsearch alignment for GI: 254780240 and conserved domain: COG3709

>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism].
Probab=97.48  E-value=0.0045  Score=40.01  Aligned_cols=151  Identities=18%  Similarity=0.192  Sum_probs=82.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCC---EE-------------------CHHHHHHHHHHHHHHHHHHHHHHHHCCCC--
Q ss_conf             9998788999678999999971894---89-------------------57899999996001456666776413445--
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVP---QL-------------------STGDMLRAEVDRNTLLGKQVKGSMESGSL--   58 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~---~i-------------------s~gdllR~~~~~~s~~g~~i~~~l~~G~l--   58 (201)
T Consensus         8 I~vvGPSGAGKDtl~~~ar~~l~~~~r~~fvrRvITRpa~ag~EdH~avs~~eF~~~a~~-----g~FAlsWqAhGL~Yg   82 (192)
T COG3709           8 IAVVGPSGAGKDTLLDAARARLAGRPRLHFVRRVITRPADAGGEDHDALSEAEFNTRAGQ-----GAFALSWQAHGLSYG   82 (192)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHC-----CCEEEEEHHCCCCCC
T ss_conf             999888877767799999987266874599999864667777655434588999988535-----762677310482225


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             54103566555420232225317863801112457888766653125222103555422125664233112323334556
Q gi|254780240|r   59 ISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSV  138 (201)
Q Consensus        59 vpd~ii~~li~~~l~~~~~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~~~~~~  138 (201)
T Consensus        83 ip~eId-----~wl~~G---~vvl~NgSRa~Lp~arrry--------~~Llvv~ita~p~VLaqRL~~RGRE--------  138 (192)
T COG3709          83 IPAEID-----LWLAAG---DVVLVNGSRAVLPQARRRY--------PQLLVVCITASPEVLAQRLAERGRE--------  138 (192)
T ss_pred             CCHHHH-----HHHHCC---CEEEEECCHHHHHHHHHHH--------HCCEEEEEECCHHHHHHHHHHHCCC--------
T ss_conf             716599-----998579---8899826276608899860--------0323699724878999999986547--------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             5678989999999999997569999999679799993899889999999999999
Q gi|254780240|r  139 RSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS  193 (201)
Q Consensus       139 R~DD~~e~i~~Rl~~y~~~~~pv~~~y~~~~~l~~Idg~~~~~eV~~~I~~~l~~  193 (201)
T Consensus       139 ----s~eeI~aRL~R~a~~~-------~~~~dv~~idNsG~l~~ag~~ll~~l~~  182 (192)
T COG3709         139 ----SREEILARLARAARYT-------AGPGDVTTIDNSGELEDAGERLLALLHQ  182 (192)
T ss_pred             ----CHHHHHHHHHHHCCCC-------CCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             ----9999999997514343-------5899868973898677899999999975