HHsearch alignment for GI: 254780240 and conserved domain: KOG0729

>KOG0729 consensus.
Probab=94.66  E-value=0.074  Score=32.38  Aligned_cols=40  Identities=20%  Similarity=0.476  Sum_probs=30.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEECH--HHHHHHHHHHH
Q ss_conf             99987889996789999999718948957--89999999600
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVPQLST--GDMLRAEVDRN   42 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~~is~--gdllR~~~~~~   42 (201)
T Consensus       214 vllyGPPGtGKTL~ARAVANRTdAcFIRViGSELVQKYvGEG  255 (435)
T KOG0729         214 VLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEG  255 (435)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHH
T ss_conf             378689998610899987456674587631189999986246