HHsearch alignment for GI: 254780240 and conserved domain: KOG0739

>KOG0739 consensus.
Probab=95.89  E-value=0.012  Score=37.32  Aligned_cols=35  Identities=31%  Similarity=0.593  Sum_probs=29.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHC--CCEECHHHHHHH
Q ss_conf             99987889996789999999718--948957899999
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLN--VPQLSTGDMLRA   37 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~--~~~is~gdllR~   37 (201)
T Consensus       169 iLLyGPPGTGKSYLAKAVATEAnSTFFSvSSSDLvSK  205 (439)
T KOG0739         169 ILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSK  205 (439)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHHH
T ss_conf             7886799975779999987414770687301788998