HHsearch alignment for GI: 254780240 and conserved domain: PRK00300

>PRK00300 gmk guanylate kinase; Provisional.
Probab=98.42  E-value=2.1e-06  Score=60.90  Aligned_cols=163  Identities=20%  Similarity=0.232  Sum_probs=85.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCC-CEECHHHHHHH----HHHHHH---HHHHHHHHHHHCCCCCCCHHHHH----HHHH
Q ss_conf             999878899967899999997189-48957899999----996001---45666677641344554103566----5554
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNV-PQLSTGDMLRA----EVDRNT---LLGKQVKGSMESGSLISDAIVNQ----VVCD   70 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~-~~is~gdllR~----~~~~~s---~~g~~i~~~l~~G~lvpd~ii~~----li~~   70 (201)
T Consensus        10 ivisGPSG~GK~tl~~~L~~~~p~~~~~~vs~TTR~pR~~E~dG~dY~Fvs~eeF~~~i~~g~FlE~~~~~g~~YGT~~~   89 (208)
T PRK00300         10 IVLSAPSGAGKSTLVRALLERDPNDLQLSVSATTRAPRPGEVDGVHYHFVSREEFEEMIENGEFLEWAEVFGNYYGTPRE   89 (208)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCEEEEECHHHHHHHHHHCCCEEEEEECCCCEECCHH
T ss_conf             99999998899999999997299868998974688989987789657996199999998628366789983870352469


Q ss_pred             HHCCC-CCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCC-CHHHHHH-HHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH
Q ss_conf             20232-225317863801112457888766653125222-1035554-22125664233112323334556567898999
Q gi|254780240|r   71 RIRLP-DCDSGFILDGYPRTVDQAKSLHAFISNMDCAID-AVIELRV-EDASMFKRIQVRVLEAIASEKSVRSDDKYDVF  147 (201)
Q Consensus        71 ~l~~~-~~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~-~vi~L~~-~~~~~~~R~~~R~~~~~~~~~~~R~DD~~e~i  147 (201)
T Consensus        90 ~I~~~~~~G~~vildidvqGa~~lk---~~~------~~~~~IFI~Pps~e~L~~RL~~Rg------------~es~~~I  148 (208)
T PRK00300         90 PVEEALAAGKDVLLEIDWQGAQQVK---KKM------PDAVSIFILPPSLEELERRLRGRG------------TDSEEVI  148 (208)
T ss_pred             HHHHHHHCCCCEEEECCHHHHHHHH---HHC------CCCEEEEEECCCHHHHHHHHHHCC------------CCCHHHH
T ss_conf             9999985699879746789999999---859------775799982889999999998638------------9988899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9999999997569999999679799993899889999999999999
Q gi|254780240|r  148 LKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS  193 (201)
Q Consensus       148 ~~Rl~~y~~~~~pv~~~y~~~~~l~~Idg~~~~~eV~~~I~~~l~~  193 (201)
T Consensus       149 ~~Rl~~A~~El~-----~~~~fD~vIiNd--dl~~a~~~l~~ii~~  187 (208)
T PRK00300        149 ARRLEAAKEEIA-----HASEYDYVIVND--DLETALEELKAIIRA  187 (208)
T ss_pred             HHHHHHHHHHHH-----HHHCCCEEEECC--CHHHHHHHHHHHHHH
T ss_conf             999999999998-----885599999899--999999999999999