HHsearch alignment for GI: 254780240 and conserved domain: PRK03731

>PRK03731 aroL shikimate kinase II; Reviewed.
Probab=99.35  E-value=2.2e-11  Score=92.13  Aligned_cols=159  Identities=21%  Similarity=0.221  Sum_probs=92.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCCCCCE
Q ss_conf             69998788999678999999971894895789999999600145666677641-34455410356655542023222531
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSME-SGSLISDAIVNQVVCDRIRLPDCDSG   80 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~-~G~lvpd~ii~~li~~~l~~~~~~~g   80 (201)
T Consensus         4 ~I~LiG~mGsGKstiGk~LA~~L~~~fiD~D~~Ie~~------~g~sI~eif~~~Ge~~FR~~E~~~l~-~l~~----~~   72 (172)
T PRK03731          4 PLFLVGPRGCGKTTVGMALAQALGYRFVDTDLWLQST------LQMTVAEIVEREGWAGFRARESAALE-AVTA----PS   72 (172)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHH------HCCCHHHHHHHHCHHHHHHHHHHHHH-HHCC----CC
T ss_conf             8899889999889999999998599979786999988------39899999998398999999999999-8427----88


Q ss_pred             EEEC---CCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC----CCCHHHHHHHHHH
Q ss_conf             7863---80111245788876665312522210355542212566423311232333455656----7898999999999
Q gi|254780240|r   81 FILD---GYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRS----DDKYDVFLKRIEN  153 (201)
Q Consensus        81 ~ilD---GFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~~~~~~R~----DD~~e~i~~Rl~~  153 (201)
T Consensus        73 ~VIstGGG~v~~~~n~~~L----~~----~g~vv~L~~~~~~l~~Rl~~~~------~~~~RPll~~~~~~~~----i~~  134 (172)
T PRK03731         73 TVVATGGGIILTEENRAFM----RN----NGIVIYLCAPVSVLANRLEADP------EEDQRPTLTGKPLSEE----VAE  134 (172)
T ss_pred             EEEEECCCCCCCHHHHHHH----HH----CCEEEEEECCHHHHHHHHHCCC------CCCCCCCCCCCCHHHH----HHH
T ss_conf             2898078642689999999----96----8999999799999999981387------7898987889987999----999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9997569999999679799993899889999999999999
Q gi|254780240|r  154 YRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS  193 (201)
Q Consensus       154 y~~~~~pv~~~y~~~~~l~~Idg~~~~~eV~~~I~~~l~~  193 (201)
T Consensus       135 l~~~R---~~~Y~~~a-~~ii~~~~~~~~i~~~Il~~L~e  170 (172)
T PRK03731        135 VLAER---DALYREVA-HHIIDATQPPSQVVSEILSALAQ  170 (172)
T ss_pred             HHHHH---HHHHHHHC-CEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999---99999848-99887989999999999998732