HHsearch alignment for GI: 254780240 and conserved domain: PRK03846

>PRK03846 adenylylsulfate kinase; Provisional.
Probab=97.84  E-value=7e-05  Score=51.33  Aligned_cols=105  Identities=22%  Similarity=0.198  Sum_probs=54.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH---CC-CEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             69998788999678999999971---89-489578999999960014566667764134455410356655542023222
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKL---NV-PQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDC   77 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~---~~-~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~~   77 (201)
T Consensus        26 viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LDGD~lR~~l~~dl--gfs~~dR~~n~~r~--~~lak~l--------~   93 (198)
T PRK03846         26 VLWFTGLSGSGKSTVAGALEEALHELGVHTYLLDGDNVRHGLCSDL--GFSDADRKENIRRV--GEVAKLM--------V   93 (198)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECHHHHHHHHCCCC--CCCHHHHHHHHHHH--HHHHHHH--------H
T ss_conf             9998799999889999999999997599759977799987436678--98999999999999--9999999--------8


Q ss_pred             CCE-EEE----CCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             531-786----38011124578887666531252221035554221256642
Q gi|254780240|r   78 DSG-FIL----DGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRI  124 (201)
Q Consensus        78 ~~g-~il----DGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~  124 (201)
T Consensus        94 ~~G~iVIvs~Isp~~~~R~~~R~~---~~~---~~f~EIyl~~~le~c~~RD  139 (198)
T PRK03846         94 DAGLVVLTAFISPHRAERQMVRER---LGE---GEFIEVFVDTPLAICEARD  139 (198)
T ss_pred             HCCCEEEECCCCCCHHHHHHHHHH---CCC---CCEEEEEECCCHHHHHHCC
T ss_conf             589836641478879999999986---787---7579999438899998738