HHsearch alignment for GI: 254780240 and conserved domain: PRK05416

>PRK05416 hypothetical protein; Provisional.
Probab=98.40  E-value=2.4e-05  Score=54.25  Aligned_cols=148  Identities=16%  Similarity=0.227  Sum_probs=85.3

Q ss_pred             CEEEE-ECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             96999-87889996789999999718948957899999996001456666776413445541035665554202322253
Q gi|254780240|r    1 MRIIF-LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDS   79 (201)
Q Consensus         1 m~I~i-~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~~~~   79 (201)
T Consensus         6 m~lviVTGlSGAGKStAl~~L-EDlGy~ciDN---------------------------lP~~Ll~~l~~~~~~~~~~~~   57 (292)
T PRK05416          6 MRLVIVTGLSGAGKSVALRAL-EDLGYYCVDN---------------------------LPPSLLPKLVELLAQSGGIDK   57 (292)
T ss_pred             EEEEEEECCCCCCHHHHHHHH-HHCCCEEECC---------------------------CCHHHHHHHHHHHHCCCCCCC
T ss_conf             689999689978799999999-8179447868---------------------------888999999999724788770


Q ss_pred             -EEEECCCHHHHH---HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH-HHCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             -178638011124---5788876665312522210355542212566423-31123233345565678989999999999
Q gi|254780240|r   80 -GFILDGYPRTVD---QAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ-VRVLEAIASEKSVRSDDKYDVFLKRIENY  154 (201)
Q Consensus        80 -g~ilDGFPRt~~---Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~-~R~~~~~~~~~~~R~DD~~e~i~~Rl~~y  154 (201)
T Consensus        58 lAv~iD~--R~~~~~~~l~~~~~~l~~~~~~~-~ilFLdA~~~~LlrRy~eTRR~HPL~~~~~----~L~eaI~~----E  126 (292)
T PRK05416         58 VAVVIDV--RSRPFFLDLPEALDELRERGIDV-RVLFLDASDEVLIRRYSETRRRHPLSGDGG----SLLEAIEL----E  126 (292)
T ss_pred             EEEEEEC--CCCCCHHHHHHHHHHHHHCCCCE-EEEEEECCHHHHHHHHHHCCCCCCCCCCCC----CHHHHHHH----H
T ss_conf             6999824--66544778999999998579955-999997886999998875068999888999----98999999----9


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHHHH
Q ss_conf             997569999999679799993899-88999999999999
Q gi|254780240|r  155 RKTILPLSSYYRDMGCLYIIDGML-DMDEVSRSIDSLLV  192 (201)
Q Consensus       155 ~~~~~pv~~~y~~~~~l~~Idg~~-~~~eV~~~I~~~l~  192 (201)
T Consensus       127 r~~L~~ir~~----A-d~vIDTS~l~~~~Lr~~i~~~~~  160 (292)
T PRK05416        127 RELLAPLRER----A-DLVIDTSELSVHQLRERIRERFG  160 (292)
T ss_pred             HHHHHHHHHH----C-CEEEECCCCCHHHHHHHHHHHHC
T ss_conf             9999999974----0-28974799999999999999865