HHsearch alignment for GI: 254780240 and conserved domain: PRK05537

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated.
Probab=96.89  E-value=0.0023  Score=41.84  Aligned_cols=155  Identities=20%  Similarity=0.198  Sum_probs=76.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH----CC-CEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             69998788999678999999971----89-48957899999996001456666776413445541035665554202322
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKL----NV-PQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPD   76 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~----~~-~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~   76 (201)
T Consensus       394 tiwlTGLsgsGKsTiA~al~~~L~~~~~~~v~lLDGD~~R~~l~~dLgfs~~--dR~enirR~--~~va~~----~~~~-  464 (568)
T PRK05537        394 TVFFTGLSGAGKSTIAKALMAKLMEMRGRPVTLLDGDVVRKHLSSELGFSKE--DRDLNILRI--GFVASE----ITKN-  464 (568)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCCCCCCHH--HHHHHHHHH--HHHHHH----HHHC-
T ss_conf             9998457888776999999999997189279995468887421557898988--999999999--999999----9858-


Q ss_pred             CCCEEEE----CCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCCCCC--CCCCCCHHHHHH
Q ss_conf             2531786----380111245788876665312522210355542212566423311232-333455--656789899999
Q gi|254780240|r   77 CDSGFIL----DGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEA-IASEKS--VRSDDKYDVFLK  149 (201)
Q Consensus        77 ~~~g~il----DGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~-~~~~~~--~R~DD~~e~i~~  149 (201)
T Consensus       465 --g~i~i~a~isP~~~~R~~~r~~---~~~~~--~f~ev~v~~ple~c~~RD~KGlY~ka~~G~i~~ftGi~~-------  530 (568)
T PRK05537        465 --GGIAICAPIAPYRATRREVREM---IEAFG--AFIEVYVATPIEVCEQRDRKGLYKKAREGKIKEFTGISD-------  530 (568)
T ss_pred             --CCEEEEEECCCCHHHHHHHHHH---HCCCC--CEEEEEECCCHHHHHHCCCCHHHHHHHCCCCCCCCCCCC-------
T ss_conf             --9789995069997999999998---52379--779999789899997728611778985799789866899-------


Q ss_pred             HHHHHHHHHHHHHHHHHH-CCCEEEECCC-CCHHHHHHHHHHHHHH
Q ss_conf             999999975699999996-7979999389-9889999999999999
Q gi|254780240|r  150 RIENYRKTILPLSSYYRD-MGCLYIIDGM-LDMDEVSRSIDSLLVS  193 (201)
Q Consensus       150 Rl~~y~~~~~pv~~~y~~-~~~l~~Idg~-~~~~eV~~~I~~~l~~  193 (201)
T Consensus       531 --------------pye~P~~pdl~idt~~~~~~~~v~~ii~~L~~  562 (568)
T PRK05537        531 --------------PYEPPANPELVIDTTNITPDECAHKILLYLEE  562 (568)
T ss_pred             --------------CCCCCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             --------------99999998079878999999999999999997