HHsearch alignment for GI: 254780240 and conserved domain: PRK08118

>PRK08118 topology modulation protein; Reviewed.
Probab=99.40  E-value=1.6e-12  Score=99.21  Aligned_cols=98  Identities=28%  Similarity=0.404  Sum_probs=75.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCEE
Q ss_conf             69998788999678999999971894895789999999600145666677641344554103566555420232225317
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGF   81 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~~~~~g~   81 (201)
T Consensus         3 rI~IiG~~GsGKSTlAr~L~~~~~ip~~~LD~l~w~----------------~~w~~~~~~e~~~~~~~~~~~----~~W   62 (167)
T PRK08118          3 KIILIGSGGSGKSTLARQLGEKLNIPVHHLDALFWK----------------PNWEGVPKEEQRTVQNELVKE----DEW   62 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEECCCEEEC----------------CCCCCCCHHHHHHHHHHHHHC----CCE
T ss_conf             799988999879999999999889697964434766----------------899468889999999999838----987


Q ss_pred             EECC-CHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8638-01112457888766653125222103555422125664233112
Q gi|254780240|r   82 ILDG-YPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVL  129 (201)
Q Consensus        82 ilDG-FPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~  129 (201)
T Consensus        63 IidGny~~~~~~r------~~----~aD~iI~Ld~p~~~~~~r~~kR~~  101 (167)
T PRK08118         63 IIDGNYGGTMDIR------LN----AADTIIFLDIPRTICLYRAFKRRV  101 (167)
T ss_pred             EEECCCHHHHHHH------HH----HCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             9947717799877------97----699999985989999999999999