HHsearch alignment for GI: 254780240 and conserved domain: PRK10078

>PRK10078 ribose 1,5-bisphosphokinase; Provisional.
Probab=98.70  E-value=1.1e-07  Score=68.79  Aligned_cols=164  Identities=14%  Similarity=0.139  Sum_probs=93.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHC-CCEECHHHHHHHHHHHHHH----HHHHHHHHHHCCCCCCCHHHHHH-------HHH
Q ss_conf             99987889996789999999718-9489578999999960014----56666776413445541035665-------554
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLN-VPQLSTGDMLRAEVDRNTL----LGKQVKGSMESGSLISDAIVNQV-------VCD   70 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~-~~~is~gdllR~~~~~~s~----~g~~i~~~l~~G~lvpd~ii~~l-------i~~   70 (201)
T Consensus         5 ivvsgPSGaGK~Tli~~l~~~~~~~~~~s~s~tTRp~e~~g~dy~fvs~eeF~~~i~~g~F~~~w~~~g~~YG~~~~v~~   84 (184)
T PRK10078          5 IWLMGPSGSGKDSLLAALRQREQTQLLVAHRYITRPASAGSENHIALSEQEFFTRAGQNLFALSWHANGLYYGVGIEIDL   84 (184)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCEECCHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHH
T ss_conf             99989986999999999984489988999872378999999682887999999999779829999866956670789999


Q ss_pred             HHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             20232225317863801112457888766653125222103555422125664233112323334556567898999999
Q gi|254780240|r   71 RIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKR  150 (201)
Q Consensus        71 ~l~~~~~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~~~~~~R~DD~~e~i~~R  150 (201)
T Consensus        85 ~l~---~G~dVi~~g~~~~~~~~~~~---~~----~~~~~~~i~ps~~~L~~RL~~RGt------------Es~e~I~~R  142 (184)
T PRK10078         85 WLH---AGFDVVVNGSRAHLPQARAR---YQ----SALLPVCLQVSPEILRQRLENRGR------------ENASEINAR  142 (184)
T ss_pred             HHH---CCCEEEEECHHHHHHHHHHH---CC----CCEEEEEECCCHHHHHHHHHHCCC------------CCHHHHHHH
T ss_conf             997---49949995179899999986---79----858999957999999999997299------------999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999975699999996797999938998899999999999999987
Q gi|254780240|r  151 IENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK  197 (201)
Q Consensus       151 l~~y~~~~~pv~~~y~~~~~l~~Idg~~~~~eV~~~I~~~l~~~~k~  197 (201)
T Consensus       143 L~~A~~--------~~-~~d~~vInnDg~le~av~~l~~ii~~~~~~  180 (184)
T PRK10078        143 LARAAR--------YQ-PQDCHTLNNDGSLRQSVDTLLTLLHQKEKH  180 (184)
T ss_pred             HHHHCC--------CC-CCCEEEEECCCCHHHHHHHHHHHHHHHHHC
T ss_conf             996121--------57-889999989988999999999999998740