HHsearch alignment for GI: 254780240 and conserved domain: PRK12339

>PRK12339 2-phosphoglycerate kinase; Provisional.
Probab=98.17  E-value=2.1e-05  Score=54.60  Aligned_cols=169  Identities=17%  Similarity=0.170  Sum_probs=81.6

Q ss_pred             EE-EECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHH-HHHHHHHHHHHHC----CCCCCCHHHHHH------HHH
Q ss_conf             99-98788999678999999971894895789999999600-1456666776413----445541035665------554
Q gi|254780240|r    3 II-FLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRN-TLLGKQVKGSMES----GSLISDAIVNQV------VCD   70 (201)
Q Consensus         3 I~-i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~-s~~g~~i~~~l~~----G~lvpd~ii~~l------i~~   70 (201)
T Consensus         5 iiligG~sGvGKStla~~lA~rlgi~~visTD~IRevlR~~i~~eP~L~~Ssy~A~~~~~~~~~~~ii~Gf~~q~~~V~~   84 (197)
T PRK12339          5 IHFIGGIPGVGKTSISGYIARHRAIDIVLSGDYLREFLRPYVDDEPVLAKSVYDAWEFYGSMTDENIVKGYLDQARAIMP   84 (197)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCEEECCHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99985799887899999999974997553434799999986688740033046798870896527899999999999999


Q ss_pred             HH----CCC-CCCCEEEECCC---HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             20----232-22531786380---11124578887666531252221035554221256642331123233345565678
Q gi|254780240|r   71 RI----RLP-DCDSGFILDGY---PRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDD  142 (201)
Q Consensus        71 ~l----~~~-~~~~g~ilDGF---PRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~~~~~~R~DD  142 (201)
T Consensus        85 gi~avi~Ra~~eg~slIIEGVHlvP~~i~------~~~~~-~~-~~~~l~i-~dee~H~~Rf~~R~~~~~~~~-------  148 (197)
T PRK12339         85 GINRVIRRALLNGEDLVIESLYFHPPMID------ENRTN-NI-RAFYLYI-RDAELHRSRLADRINYTHKNS-------  148 (197)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECHHHHH------HHHHC-CE-EEEEEEE-CCHHHHHHHHHHHHHHCCCCC-------
T ss_conf             99999999997399779985211778877------88765-95-8999997-888999999999854312677-------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHH---CCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9899999999999975699999996---7979999389988999999999999
Q gi|254780240|r  143 KYDVFLKRIENYRKTILPLSSYYRD---MGCLYIIDGMLDMDEVSRSIDSLLV  192 (201)
Q Consensus       143 ~~e~i~~Rl~~y~~~~~pv~~~y~~---~~~l~~Idg~~~~~eV~~~I~~~l~  192 (201)
T Consensus       149 -p---~~ry~~~f~~IR~Iq~ylv~~A~~~~ipvI~n~-~~d~s~~~i~~~i~  196 (197)
T PRK12339        149 -P---GKRLAEHLPEYRTIMDYSIADARGYNIKVIDTD-NYREARNPLLDPIS  196 (197)
T ss_pred             -H---HHHHHHHHHHHHHHHHHHHHHHHHCCCCEECCC-CHHHHHHHHHHHHH
T ss_conf             -1---669999899999999999998887399855377-28999999999840