HHsearch alignment for GI: 254780240 and conserved domain: PRK13477

>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional.
Probab=99.14  E-value=2.2e-10  Score=85.79  Aligned_cols=175  Identities=20%  Similarity=0.229  Sum_probs=92.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHH----HHHHH--HHHHHHHHH------------------HCCCC
Q ss_conf             9998788999678999999971894895789999999----60014--566667764------------------13445
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEV----DRNTL--LGKQVKGSM------------------ESGSL   58 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~----~~~s~--~g~~i~~~l------------------~~G~l   58 (201)
T Consensus       287 IAIDGPAgSGKSTvAK~lA~~L~~~yLDTGamYRAva~~~l~~~i~~~d~~~l~~~l~~~~i~~~~~~~~~~~i~lng~d  366 (512)
T PRK13477        287 IAIDGPAGAGKSTVTRAVAKKLGLLYLDTGAMYRAVTWLVLQEGIDPQDEEALAELLSDLKLELKPSSGSPQRVWINGED  366 (512)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCEEEECCCCCCEEEEECCEE
T ss_conf             99867875787899999999819968624499999999999759697689999999872987983188876289988857


Q ss_pred             CCCHH----H---------HHHHHHHH----CCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             54103----5---------66555420----2322253178638011124578887666531252221035554221256
Q gi|254780240|r   59 ISDAI----V---------NQVVCDRI----RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF  121 (201)
Q Consensus        59 vpd~i----i---------~~li~~~l----~~~~~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~  121 (201)
T Consensus       367 vt~~IRs~eVs~~vS~vA~~p~VR~~l~~~QR~~a~~~g~V~eG--RDIGTVV-----fP----dA~lK~fLtAs~e~RA  435 (512)
T PRK13477        367 VTEAIRSPEVTSSVSAIAAQPCVRQALVKQQQRIGEKGGLVAEG--RDIGTHV-----FP----DAELKIFLTASVEERA  435 (512)
T ss_pred             HHHHHCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEEC--CCCCCEE-----CC----CCCEEEEEECCHHHHH
T ss_conf             06655447889999998397989999999999984659999979--9876667-----78----9996699989999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHCCCEEEECCC-CCHHHHHHHHHHHHHHH
Q ss_conf             64233112323334556567898999999-999999756999999967979999389-98899999999999999
Q gi|254780240|r  122 KRIQVRVLEAIASEKSVRSDDKYDVFLKR-IENYRKTILPLSSYYRDMGCLYIIDGM-LDMDEVSRSIDSLLVSV  194 (201)
Q Consensus       122 ~R~~~R~~~~~~~~~~~R~DD~~e~i~~R-l~~y~~~~~pv~~~y~~~~~l~~Idg~-~~~~eV~~~I~~~l~~~  194 (201)
T Consensus       436 ~RR~~el~~--~g~~~~s~~~i~~~I~~RD~~D~~R~~sPL~~----A~DAi~IDTs~lsieeVv~kI~~l~~~k  504 (512)
T PRK13477        436 RRRALDLEA--QGFPVIDLEELEAQIAERDRLDSTREIAPLRK----ADDAIELITDGLSIEEVVDKIIDLYRDR  504 (512)
T ss_pred             HHHHHHHHH--CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC----CCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             999999996--68887899999999998614314477688865----8984899899999999999999999975