HHsearch alignment for GI: 254780240 and conserved domain: PRK13951

>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional.
Probab=98.93  E-value=3.2e-08  Score=72.27  Aligned_cols=154  Identities=16%  Similarity=0.282  Sum_probs=84.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHCCCC---
Q ss_conf             9699987889996789999999718948957899999996001456666776413-445541035665554202322---
Q gi|254780240|r    1 MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMES-GSLISDAIVNQVVCDRIRLPD---   76 (201)
Q Consensus         1 m~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~~-G~lvpd~ii~~li~~~l~~~~---   76 (201)
T Consensus         1 m~I~LiG~mGaGKTtvGr~LA~~L~~~FvD~D~~Ie~~------~G~sI~eIF~~~GE~~FR~~E~~~l~~l~~~~~~Vi   74 (488)
T PRK13951          1 MRIFLVGMMGSGKSTIGKRISEVLDLQFIDMDEEIERR------EGRSVRRIFEEDGEEYFRLKEKELLRELVERDNVVV   74 (488)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEECHHHHHHH------HCCCHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             94999899999877999999998397956477999998------599888999887889999999999999860899699


Q ss_pred             -CCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             -2531786380111245788876665312522210355542212566423311232333455656789899999999999
Q gi|254780240|r   77 -CDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYR  155 (201)
Q Consensus        77 -~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~~~~~~~~~R~DD~~e~i~~Rl~~y~  155 (201)
T Consensus        75 atGGGavl~--~~nr---~~----L~~-----~~vV~L~a~~e~l~~R~~~~~------RPLL~-~-~~----~rl~~L~  128 (488)
T PRK13951         75 ATGGGVVID--PENR---EL----LKK-----EKTLFLYAPPEVLMERVTTEN------RPLLR-E-GK----ERIREIW  128 (488)
T ss_pred             ECCCCCCCC--HHHH---HH----HHC-----CCEEEEECCHHHHHHHHCCCC------CCCCC-C-CH----HHHHHHH
T ss_conf             769823289--9999---99----964-----988999899999999837899------98889-9-48----9999999


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             97569999999679799993899889999999999
Q gi|254780240|r  156 KTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSL  190 (201)
Q Consensus       156 ~~~~pv~~~y~~~~~l~~Idg~~~~~eV~~~I~~~  190 (201)
T Consensus       129 ~~R~p~---Y~e~~~-i~~~~~~~~~~~a~~~~~~  159 (488)
T PRK13951        129 ERRKQF---YTEFRG-IDTSKLNEWETTALVVLEA  159 (488)
T ss_pred             HHHHHH---HHHHCC-EECCCCCCHHHHHHHHHHH
T ss_conf             987688---998541-0046897266699999998