HHsearch alignment for GI: 254780240 and conserved domain: cd00464

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=98.94  E-value=5.2e-09  Score=77.20  Aligned_cols=108  Identities=16%  Similarity=0.256  Sum_probs=67.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCCCCCE
Q ss_conf             69998788999678999999971894895789999999600145666677641-34455410356655542023222531
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSME-SGSLISDAIVNQVVCDRIRLPDCDSG   80 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~-~G~lvpd~ii~~li~~~l~~~~~~~g   80 (201)
T Consensus         1 nI~LiG~~G~GKstigk~la~~l~~~fiD~D~~Ie~~------~g~si~eif~~~Ge~~FR~~E~~~l~~~~~----~~~   70 (154)
T cd00464           1 NIVLIGMMGAGKTTVGRLLAKALGLPFVDLDELIEQR------AGMSIPEIFAEEGEEGFRELEREVLLLLLT----KEN   70 (154)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHH------HCCCHHHHHHHCCHHHHHHHHHHHHHHHHC----CCC
T ss_conf             9899889999889999999999798979685999999------499999999874938789999999999856----898


Q ss_pred             EEEC---CCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             7863---8011124578887666531252221035554221256642331
Q gi|254780240|r   81 FILD---GYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVR  127 (201)
Q Consensus        81 ~ilD---GFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R  127 (201)
T Consensus        71 ~VIs~GGG~v~~~~~~~~l----~~----~~~vI~L~~~~~~l~~Rl~~~  112 (154)
T cd00464          71 AVIATGGGAVLREENRRLL----LE----NGIVVWLDASPEELLERLARD  112 (154)
T ss_pred             EEEECCCCCCCCHHHHHHH----HH----CCEEEEEECCHHHHHHHHHCC
T ss_conf             5997389733689999999----95----790899957999999996079