HHsearch alignment for GI: 254780240 and conserved domain: cd01120

>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=96.15  E-value=0.0055  Score=39.47  Aligned_cols=36  Identities=31%  Similarity=0.501  Sum_probs=26.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH---C--CCEECHHHHHHH
Q ss_conf             69998788999678999999971---8--948957899999
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKL---N--VPQLSTGDMLRA   37 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~---~--~~~is~gdllR~   37 (201)
T Consensus         1 ~~li~g~~g~GKttl~~~~~~~~~~~~~~~~~~~~ee~~~q   41 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEE   41 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHH
T ss_conf             98999899998999999999998763997999986664489