HHsearch alignment for GI: 254780240 and conserved domain: cd01394

>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=94.98  E-value=0.025  Score=35.31  Aligned_cols=30  Identities=33%  Similarity=0.540  Sum_probs=22.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHH---C--CCEECHH
Q ss_conf             9998788999678999999971---8--9489578
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKL---N--VPQLSTG   32 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~---~--~~~is~g   32 (201)
T Consensus        22 t~i~G~pG~GKStl~lq~a~~~~~~g~~v~YidtE   56 (218)
T cd01394          22 TQVYGPPGTGKTNIAIQLAVETAGQGKKVAYIDTE   56 (218)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             99989999849999999999986369869999665