HHsearch alignment for GI: 254780240 and conserved domain: cd02021

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=98.85  E-value=1.2e-08  Score=74.85  Aligned_cols=115  Identities=20%  Similarity=0.230  Sum_probs=67.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH---HHHHHHHHHCC--CCC
Q ss_conf             9998788999678999999971894895789999999600145666677641344554103---56655542023--222
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI---VNQVVCDRIRL--PDC   77 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~~l~~G~lvpd~i---i~~li~~~l~~--~~~   77 (201)
T Consensus         2 iiv~GvsGsGKSTia~~La~~lg~~~i~-~D~~h~~---------~n~~km~~G~pL~d~dr~~wl~~l~~~~~~~~~~~   71 (150)
T cd02021           2 IVVMGVSGSGKSTVGKALAERLGAPFID-GDDLHPP---------ANIAKMAAGIPLNDEDRWPWLQALTDALLAKLASA   71 (150)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEC-CCCCCCH---------HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             8999189999999999999971995641-5433547---------68999867999885237899999999999999844


Q ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             53178638011124578887666531252221035554221256642331123
Q gi|254780240|r   78 DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLE  130 (201)
Q Consensus        78 ~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~  130 (201)
T Consensus        72 g~~vVv~cSaLk~~yR~~l~~~~~---~~~v~fi~L~~~~~~l~~Rl~~R~~h  121 (150)
T cd02021          72 GEGVVVACSALKRIYRDILRGGAA---NPRVRFVHLDGPREVLAERLAARKGH  121 (150)
T ss_pred             CCCEEEEEHHHHHHHHHHHHHHCC---CCCEEEEEEECCHHHHHHHHHHCCCC
T ss_conf             998799843323999999995276---89858999869999999999846357