HHsearch alignment for GI: 254780240 and conserved domain: pfam00308

>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=94.54  E-value=0.08  Score=32.16  Aligned_cols=38  Identities=24%  Similarity=0.315  Sum_probs=27.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHH-------CCCEECHHHHHHHHHH
Q ss_conf             9998788999678999999971-------8948957899999996
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKL-------NVPQLSTGDMLRAEVD   40 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~-------~~~~is~gdllR~~~~   40 (201)
T Consensus        37 l~i~G~~G~GKTHLLqA~~~~~~~~~~~~~v~yl~~~~~~~~~~~   81 (219)
T pfam00308        37 LFIYGGVGLGKTHLLHAIGNYALRNFPNLRVVYLTSEEFLNDFVD   81 (219)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHH
T ss_conf             699889999888999999999998499982888439999998899