HHsearch alignment for GI: 254780240 and conserved domain: pfam01078

>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Probab=96.37  E-value=0.0023  Score=41.83  Aligned_cols=32  Identities=44%  Similarity=0.779  Sum_probs=24.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHH
Q ss_conf             6999878899967899999997189489578999
Q gi|254780240|r    2 RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDML   35 (201)
Q Consensus         2 ~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdll   35 (201)
T Consensus        24 ~lLl~GpPG~GKTmlA~rl~~iL--P~l~~~e~l   55 (207)
T pfam01078        24 NLLMIGPPGSGKTMLAKRLPGIL--PPLTEQEAL   55 (207)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCC--CCCCHHHHH
T ss_conf             58978899802999997630148--998789988