HHsearch alignment for GI: 254780240 and conserved domain: pfam06414

>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=98.59  E-value=2.2e-07  Score=66.98  Aligned_cols=120  Identities=23%  Similarity=0.246  Sum_probs=73.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHH---CCCEECHHHHHHHHHHHHHH----HHHHHHHHHHCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             9998788999678999999971---89489578999999960014----5666677641344554103566555420232
Q gi|254780240|r    3 IIFLGPPGSGKGTQACRLSQKL---NVPQLSTGDMLRAEVDRNTL----LGKQVKGSMESGSLISDAIVNQVVCDRIRLP   75 (201)
Q Consensus         3 I~i~G~PGsGK~T~a~~la~~~---~~~~is~gdllR~~~~~~s~----~g~~i~~~l~~G~lvpd~ii~~li~~~l~~~   75 (201)
T Consensus        15 i~laG~pGAGKS~~~~~~~~~~~~~~~v~In~-D~~r~~~P~y~~l~~~~~~~~~~~~~~---~a~~~~~~~~~~a~---   87 (191)
T pfam06414        15 VLLGGQPGAGKTELARALLEELGGGNVVRIDP-DELRTYHPDYDELQKADPKDASELTQP---DASRWVEKLIDYAI---   87 (191)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCEEECC-HHHHHHHHHHHHHHHCCHHHHHHHHHH---HHHHHHHHHHHHHH---
T ss_conf             99957998888999999987537899389713-587887774786554076778999899---99999999999999---


Q ss_pred             CCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             2253178638011124578887666531252221035554221256642331123
Q gi|254780240|r   76 DCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLE  130 (201)
Q Consensus        76 ~~~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~~~~~~R~~~R~~~  130 (201)
T Consensus        88 ~~r~n~iiegT~~~~~~~~~~~~~lk~~GY~v-~v~~Va~~~e~S~~r~~~Ry~~  141 (191)
T pfam06414        88 ERGYNIILEGTLRSPDVARKLARKLKAAGYEV-EVYVVAVPPELSWLGVLDRYEE  141 (191)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHCCCEE-EEEEEECCHHHHHHHHHHHHHH
T ss_conf             75999898577789799999999999789979-9999988999999999999985