BLAST/PSIBLAST alignment of GI: 254780240 and GI: 17987061 at iteration 1
>gi|17987061|ref|NP_539695.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M] Length = 194
>gi|256044862|ref|ZP_05447766.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1] Length = 194
>gi|260565536|ref|ZP_05836020.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M] Length = 194
>gi|265991289|ref|ZP_06103846.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1] Length = 194
>gi|20138474|sp|Q8YHL9|KAD_BRUME RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP transphosphorylase Length = 194
>gi|17982718|gb|AAL51959.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M] Length = 194
>gi|260151604|gb|EEW86698.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M] Length = 194
>gi|263002073|gb|EEZ14648.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1] Length = 194
 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L II+GM  +
Sbjct: 121 VKRMESRVAETIAKGAQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRIINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192