BLAST/PSIBLAST alignment of GI: 254780240 and GI: 256061292 at iteration 1
>gi|256061292|ref|ZP_05451442.1| adenylate kinase [Brucella neotomae 5K33] Length = 194
>gi|261325299|ref|ZP_05964496.1| adenylate kinase [Brucella neotomae 5K33] Length = 194
>gi|261301279|gb|EEY04776.1| adenylate kinase [Brucella neotomae 5K33] Length = 194
 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  P+C +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPECANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192