BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (201 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039917|gb|ACT56713.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 201

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS
Sbjct: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM
Sbjct: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM
Sbjct: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180

Query: 181 DEVSRSIDSLLVSVRKKCSSS 201
           DEVSRSIDSLLVSVRKKCSSS
Sbjct: 181 DEVSRSIDSLLVSVRKKCSSS 201


>gi|315122797|ref|YP_004063286.1| adenylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496199|gb|ADR52798.1| adenylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 201

 Score =  301 bits (771), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 170/201 (84%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRIIFLGPPG+GKGTQA RLS KLN+PQLSTGDMLRAEV + T +GKQVK  MESG LIS
Sbjct: 1   MRIIFLGPPGAGKGTQAARLSHKLNIPQLSTGDMLRAEVSKGTFIGKQVKNIMESGHLIS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+IVN+VVCDRI   DC  GFILDGYPRTVDQA++L   +S M+C IDAVIEL+V+D+ M
Sbjct: 61  DSIVNRVVCDRIGHSDCSGGFILDGYPRTVDQAQNLQIIVSGMNCCIDAVIELQVDDSLM 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           FKRI+ RV +AI+SEKSVRSDDKYDVF++R+E+YR+  +PLSSYYRD GCL++IDGMLD 
Sbjct: 121 FKRIESRVSKAISSEKSVRSDDKYDVFIRRMEDYRRVTVPLSSYYRDRGCLHVIDGMLDA 180

Query: 181 DEVSRSIDSLLVSVRKKCSSS 201
           D VSR IDSLLVS+  KC  S
Sbjct: 181 DTVSRDIDSLLVSIEGKCCRS 201


>gi|325293315|ref|YP_004279179.1| adenylate kinase [Agrobacterium sp. H13-3]
 gi|325061168|gb|ADY64859.1| adenylate kinase [Agrobacterium sp. H13-3]
          Length = 196

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 138/191 (72%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA RL+ K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKRLTDKYGIPQLSTGDMLRAAVSAGTEIGKRAKAVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC  GFILDGYPRTV QAK+L   +   + A+DAVIEL+V++ ++
Sbjct: 61  DDIVNQIVSERIEAPDCAKGFILDGYPRTVPQAKALAENMHKKNVALDAVIELKVDEEAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV E IA+  +VRSDD  + F KR+  YR+   PLS YY + G L  +DGM D+
Sbjct: 121 IRRIENRVAETIAAGGTVRSDDNPEAFRKRLTEYREKTAPLSQYYSEQGELVTLDGMADV 180

Query: 181 DEVSRSIDSLL 191
           D V+ +I+ +L
Sbjct: 181 DAVTAAIERVL 191


>gi|15889221|ref|NP_354902.1| adenylate kinase [Agrobacterium tumefaciens str. C58]
 gi|22653804|sp|Q8UE38|KAD_AGRT5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|15157048|gb|AAK87687.1| adenylate kinase [Agrobacterium tumefaciens str. C58]
          Length = 196

 Score =  218 bits (556), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/191 (53%), Positives = 138/191 (72%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA RL+ K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKRLTDKYGIPQLSTGDMLRAAVSAGTEIGKRAKAVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC  GFILDGYPRTV QAK+L   +   +  +DAVIEL+V++ ++
Sbjct: 61  DDIVNQIVSERIEAPDCAKGFILDGYPRTVPQAKALADNMRKKNQVLDAVIELKVDEEAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV E IA+  +VRSDD  + F KR+  YR+   PLS+YY + G L  +DGM D+
Sbjct: 121 IRRIENRVAETIAAGGTVRSDDNPEAFRKRLTEYREKTAPLSAYYSEQGELVTLDGMADV 180

Query: 181 DEVSRSIDSLL 191
           D V+ +I+ +L
Sbjct: 181 DAVTEAIERVL 191


>gi|17987061|ref|NP_539695.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|256044862|ref|ZP_05447766.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565536|ref|ZP_05836020.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|265991289|ref|ZP_06103846.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|20138474|sp|Q8YHL9|KAD_BRUME RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|17982718|gb|AAL51959.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260151604|gb|EEW86698.1| adenylate kinase [Brucella melitensis bv. 1 str. 16M]
 gi|263002073|gb|EEZ14648.1| adenylate kinase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 194

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L II+GM  +
Sbjct: 121 VKRMESRVAETIAKGAQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRIINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|62290123|ref|YP_221916.1| adenylate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82700046|ref|YP_414620.1| adenylate kinase [Brucella melitensis biovar Abortus 2308]
 gi|189024361|ref|YP_001935129.1| Adenylate kinase, subfamily [Brucella abortus S19]
 gi|225852709|ref|YP_002732942.1| adenylate kinase [Brucella melitensis ATCC 23457]
 gi|237815631|ref|ZP_04594628.1| adenylate kinase [Brucella abortus str. 2308 A]
 gi|254689432|ref|ZP_05152686.1| adenylate kinase [Brucella abortus bv. 6 str. 870]
 gi|254693917|ref|ZP_05155745.1| adenylate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|254697567|ref|ZP_05159395.1| adenylate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730461|ref|ZP_05189039.1| adenylate kinase [Brucella abortus bv. 4 str. 292]
 gi|256113766|ref|ZP_05454570.1| adenylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|256257678|ref|ZP_05463214.1| adenylate kinase [Brucella abortus bv. 9 str. C68]
 gi|256263801|ref|ZP_05466333.1| adenylate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|260546671|ref|ZP_05822410.1| adenylate kinase [Brucella abortus NCTC 8038]
 gi|260754955|ref|ZP_05867303.1| adenylate kinase [Brucella abortus bv. 6 str. 870]
 gi|260758171|ref|ZP_05870519.1| adenylate kinase [Brucella abortus bv. 4 str. 292]
 gi|260761997|ref|ZP_05874340.1| adenylate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883964|ref|ZP_05895578.1| adenylate kinase [Brucella abortus bv. 9 str. C68]
 gi|261214209|ref|ZP_05928490.1| adenylate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|265995126|ref|ZP_06107683.1| adenylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|297248518|ref|ZP_06932236.1| adenylate kinase [Brucella abortus bv. 5 str. B3196]
 gi|81309410|sp|Q57CS9|KAD_BRUAB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123547525|sp|Q2YRT7|KAD_BRUA2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238689382|sp|B2S658|KAD_BRUA1 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806975|sp|C0RJI0|KAD_BRUMB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|62196255|gb|AAX74555.1| Adk, adenylate kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82616147|emb|CAJ11190.1| Shikimate kinase:Adenylate kinase:Adenylate kinase, subfamily
           [Brucella melitensis biovar Abortus 2308]
 gi|189019933|gb|ACD72655.1| Adenylate kinase, subfamily [Brucella abortus S19]
 gi|225641074|gb|ACO00988.1| adenylate kinase [Brucella melitensis ATCC 23457]
 gi|237788929|gb|EEP63140.1| adenylate kinase [Brucella abortus str. 2308 A]
 gi|260095721|gb|EEW79598.1| adenylate kinase [Brucella abortus NCTC 8038]
 gi|260668489|gb|EEX55429.1| adenylate kinase [Brucella abortus bv. 4 str. 292]
 gi|260672429|gb|EEX59250.1| adenylate kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675063|gb|EEX61884.1| adenylate kinase [Brucella abortus bv. 6 str. 870]
 gi|260873492|gb|EEX80561.1| adenylate kinase [Brucella abortus bv. 9 str. C68]
 gi|260915816|gb|EEX82677.1| adenylate kinase [Brucella abortus bv. 3 str. Tulya]
 gi|262766239|gb|EEZ12028.1| adenylate kinase [Brucella melitensis bv. 3 str. Ether]
 gi|263093929|gb|EEZ17863.1| adenylate kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|297175687|gb|EFH35034.1| adenylate kinase [Brucella abortus bv. 5 str. B3196]
 gi|326409234|gb|ADZ66299.1| Adenylate kinase, subfamily [Brucella melitensis M28]
 gi|326538942|gb|ADZ87157.1| adenylate kinase [Brucella melitensis M5-90]
          Length = 194

 Score =  213 bits (541), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L II+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRIINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|23502089|ref|NP_698216.1| adenylate kinase [Brucella suis 1330]
 gi|148558939|ref|YP_001259132.1| adenylate kinase [Brucella ovis ATCC 25840]
 gi|161619168|ref|YP_001593055.1| adenylate kinase [Brucella canis ATCC 23365]
 gi|225627684|ref|ZP_03785721.1| adenylate kinase [Brucella ceti str. Cudo]
 gi|254701953|ref|ZP_05163781.1| adenylate kinase [Brucella suis bv. 5 str. 513]
 gi|254704497|ref|ZP_05166325.1| adenylate kinase [Brucella suis bv. 3 str. 686]
 gi|254706607|ref|ZP_05168435.1| adenylate kinase [Brucella pinnipedialis M163/99/10]
 gi|254710283|ref|ZP_05172094.1| adenylate kinase [Brucella pinnipedialis B2/94]
 gi|254714280|ref|ZP_05176091.1| adenylate kinase [Brucella ceti M644/93/1]
 gi|254717717|ref|ZP_05179528.1| adenylate kinase [Brucella ceti M13/05/1]
 gi|254719270|ref|ZP_05181081.1| adenylate kinase [Brucella sp. 83/13]
 gi|256031777|ref|ZP_05445391.1| adenylate kinase [Brucella pinnipedialis M292/94/1]
 gi|256159947|ref|ZP_05457665.1| adenylate kinase [Brucella ceti M490/95/1]
 gi|256255178|ref|ZP_05460714.1| adenylate kinase [Brucella ceti B1/94]
 gi|256369636|ref|YP_003107146.1| adenylate kinase [Brucella microti CCM 4915]
 gi|260168911|ref|ZP_05755722.1| adenylate kinase [Brucella sp. F5/99]
 gi|260566259|ref|ZP_05836729.1| adenylate kinase [Brucella suis bv. 4 str. 40]
 gi|261219560|ref|ZP_05933841.1| adenylate kinase [Brucella ceti M13/05/1]
 gi|261222374|ref|ZP_05936655.1| adenylate kinase [Brucella ceti B1/94]
 gi|261314066|ref|ZP_05953263.1| adenylate kinase [Brucella pinnipedialis M163/99/10]
 gi|261317846|ref|ZP_05957043.1| adenylate kinase [Brucella pinnipedialis B2/94]
 gi|261322055|ref|ZP_05961252.1| adenylate kinase [Brucella ceti M644/93/1]
 gi|261752521|ref|ZP_05996230.1| adenylate kinase [Brucella suis bv. 5 str. 513]
 gi|261755180|ref|ZP_05998889.1| adenylate kinase [Brucella suis bv. 3 str. 686]
 gi|261758404|ref|ZP_06002113.1| adenylate kinase [Brucella sp. F5/99]
 gi|265984270|ref|ZP_06097005.1| adenylate kinase [Brucella sp. 83/13]
 gi|265988875|ref|ZP_06101432.1| adenylate kinase [Brucella pinnipedialis M292/94/1]
 gi|265998339|ref|ZP_06110896.1| adenylate kinase [Brucella ceti M490/95/1]
 gi|306838022|ref|ZP_07470880.1| adenylate kinase [Brucella sp. NF 2653]
 gi|306844116|ref|ZP_07476710.1| adenylate kinase [Brucella sp. BO1]
 gi|29427500|sp|Q8G092|KAD_BRUSU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980300|sp|A5VQY5|KAD_BRUO2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|189046006|sp|A9M5M9|KAD_BRUC2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|23348048|gb|AAN30131.1| adenylate kinase [Brucella suis 1330]
 gi|148370196|gb|ABQ60175.1| adenylate kinase [Brucella ovis ATCC 25840]
 gi|161335979|gb|ABX62284.1| adenylate kinase [Brucella canis ATCC 23365]
 gi|225617689|gb|EEH14734.1| adenylate kinase [Brucella ceti str. Cudo]
 gi|255999798|gb|ACU48197.1| adenylate kinase [Brucella microti CCM 4915]
 gi|260155777|gb|EEW90857.1| adenylate kinase [Brucella suis bv. 4 str. 40]
 gi|260920958|gb|EEX87611.1| adenylate kinase [Brucella ceti B1/94]
 gi|260924649|gb|EEX91217.1| adenylate kinase [Brucella ceti M13/05/1]
 gi|261294745|gb|EEX98241.1| adenylate kinase [Brucella ceti M644/93/1]
 gi|261297069|gb|EEY00566.1| adenylate kinase [Brucella pinnipedialis B2/94]
 gi|261303092|gb|EEY06589.1| adenylate kinase [Brucella pinnipedialis M163/99/10]
 gi|261738388|gb|EEY26384.1| adenylate kinase [Brucella sp. F5/99]
 gi|261742274|gb|EEY30200.1| adenylate kinase [Brucella suis bv. 5 str. 513]
 gi|261744933|gb|EEY32859.1| adenylate kinase [Brucella suis bv. 3 str. 686]
 gi|262552807|gb|EEZ08797.1| adenylate kinase [Brucella ceti M490/95/1]
 gi|264661072|gb|EEZ31333.1| adenylate kinase [Brucella pinnipedialis M292/94/1]
 gi|264662862|gb|EEZ33123.1| adenylate kinase [Brucella sp. 83/13]
 gi|306275559|gb|EFM57291.1| adenylate kinase [Brucella sp. BO1]
 gi|306406946|gb|EFM63167.1| adenylate kinase [Brucella sp. NF 2653]
          Length = 194

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|163843478|ref|YP_001627882.1| adenylate kinase [Brucella suis ATCC 23445]
 gi|189046007|sp|B0CH11|KAD_BRUSI RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|163674201|gb|ABY38312.1| adenylate kinase [Brucella suis ATCC 23445]
          Length = 194

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVAAEIERILV 192


>gi|294852548|ref|ZP_06793221.1| adenylate kinase [Brucella sp. NVSL 07-0026]
 gi|294821137|gb|EFG38136.1| adenylate kinase [Brucella sp. NVSL 07-0026]
          Length = 194

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMKSRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|256061292|ref|ZP_05451442.1| adenylate kinase [Brucella neotomae 5K33]
 gi|261325299|ref|ZP_05964496.1| adenylate kinase [Brucella neotomae 5K33]
 gi|261301279|gb|EEY04776.1| adenylate kinase [Brucella neotomae 5K33]
          Length = 194

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  P+C +GFILDGYPRTV QA++L   +S     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPECANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|153009307|ref|YP_001370522.1| adenylate kinase [Ochrobactrum anthropi ATCC 49188]
 gi|166980342|sp|A6X0D9|KAD_OCHA4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|151561195|gb|ABS14693.1| adenylate kinase [Ochrobactrum anthropi ATCC 49188]
          Length = 194

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   ++     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALGTMLAGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTSPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|239832101|ref|ZP_04680430.1| adenylate kinase [Ochrobactrum intermedium LMG 3301]
 gi|239824368|gb|EEQ95936.1| adenylate kinase [Ochrobactrum intermedium LMG 3301]
          Length = 194

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 137/192 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L++K  +PQLSTGDMLRA V + + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGLLTKKHGIPQLSTGDMLRAAVAQQSEIGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   ++     +DAVIEL+V++ ++
Sbjct: 61  DEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALGTMLAGKGLKLDAVIELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L +I+GM  +
Sbjct: 121 VKRMESRVNETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELRVINGMAPV 180

Query: 181 DEVSRSIDSLLV 192
           +EV+  I+ +LV
Sbjct: 181 EEVTAEIERILV 192


>gi|319407405|emb|CBI81056.1| adenylate kinase [Bartonella sp. 1-1C]
          Length = 192

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 136/191 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA  L+++ N+PQLSTGDMLRA + + T +GK+ K  MESGSL+S
Sbjct: 1   MKVILLGPPGAGKGTQAKMLTEEYNIPQLSTGDMLRAVIMKKTEVGKEAKAIMESGSLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V DRI   DC  GFILDGYPRT+ QA++L   + + +  +DAVIEL V++ ++
Sbjct: 61  DDIVNQIVSDRISESDCAGGFILDGYPRTLAQAEALQQILKSKNVQLDAVIELVVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV EA+ S   VRSDD    F KR+  YR+   P+S +Y D+G L  +DGM D+
Sbjct: 121 IERIKKRVQEAVVSGGLVRSDDNPSAFAKRLVEYREKTAPVSKFYSDIGLLKTVDGMADI 180

Query: 181 DEVSRSIDSLL 191
            +VSR+I  L 
Sbjct: 181 SDVSRAIKELF 191


>gi|150396228|ref|YP_001326695.1| adenylate kinase [Sinorhizobium medicae WSM419]
 gi|166980521|sp|A6U880|KAD_SINMW RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|150027743|gb|ABR59860.1| adenylate kinase [Sinorhizobium medicae WSM419]
          Length = 192

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 136/192 (70%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA  L+++  +PQLSTGDMLRA V + T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKHLTERYGIPQLSTGDMLRAAVAQATEVGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V DRI  PDC  GFILDGYPRTV QA +L   +   +  +DAVIEL+V++A++
Sbjct: 61  DEIVNEIVSDRIDAPDCAKGFILDGYPRTVPQAVALDRMLEEKNLKLDAVIELKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E +A+  +VRSDD  + F +R++ YR+   PLS +Y   G L  +DGM D+
Sbjct: 121 VRRMENRVAETVAAGGTVRSDDNPEAFRRRLQEYREKTAPLSEHYARTGRLKTVDGMADV 180

Query: 181 DEVSRSIDSLLV 192
             V+  I+ +L 
Sbjct: 181 KTVTAEIEKILA 192


>gi|253684212|gb|ACT33325.1| putative adenylate kinase [uncultured Sinorhizobium sp.]
          Length = 192

 Score =  207 bits (527), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 97/192 (50%), Positives = 135/192 (70%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA  L+++  +PQLSTGDMLRA V + T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKLLTERYGIPQLSTGDMLRAAVAQATEVGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V DRI  PDC  GFILDGYPRTV QA +L   +      +DAVIEL+V++A++
Sbjct: 61  DEIVNEIVSDRIDQPDCAKGFILDGYPRTVPQAIALGKMLEGKGLKLDAVIELKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR++ RV E IA+  +VRSDD  + F +R+  YR+   PLS +Y   G L  +DGM ++
Sbjct: 121 VKRMENRVAETIAAGGTVRSDDNPEAFKRRLTEYREKTAPLSEHYAGTGQLRTVDGMAEV 180

Query: 181 DEVSRSIDSLLV 192
           + V+  I+ +L 
Sbjct: 181 NTVTAEIEKILA 192


>gi|227821776|ref|YP_002825746.1| adenylate kinase [Sinorhizobium fredii NGR234]
 gi|227340775|gb|ACP24993.1| adenylate kinase [Sinorhizobium fredii NGR234]
          Length = 192

 Score =  204 bits (518), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 135/191 (70%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA  L+++  +PQLSTGDMLRA V + T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKLLTERYGIPQLSTGDMLRAAVAQATEVGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V DRI   DC  GFILDGYPRTV QA +L   + +    +DAV+EL+V++A++
Sbjct: 61  DEIVNEIVSDRIDAQDCAKGFILDGYPRTVPQAIALDRMLDSKGLKLDAVVELKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E +A+  +VRSDD  + F +R+  YR+   PLS +Y   G L  +DGM D+
Sbjct: 121 VRRMENRVAETVAAGGTVRSDDNPEAFKRRLTEYREKTAPLSEHYAQTGQLKTVDGMADV 180

Query: 181 DEVSRSIDSLL 191
           + V+  ID +L
Sbjct: 181 EAVTAEIDKIL 191


>gi|319404404|emb|CBI78007.1| adenylate kinase [Bartonella rochalimae ATCC BAA-1498]
          Length = 191

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 134/187 (71%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA  L+++ N+PQLSTGDMLRA + + T +GK+ K  MESGSL+S
Sbjct: 1   MKVILLGPPGAGKGTQAKMLTEEYNIPQLSTGDMLRAVIMKETEVGKEAKAIMESGSLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V DRI   DC  GFILDGYPRT+ QA++L   + + +  +DAVIEL V++ ++
Sbjct: 61  DDIVNRIVSDRISESDCVGGFILDGYPRTLAQAEALQQILKSKNVQLDAVIELVVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV E + S   VRSDD    F KR+  YR+   P+S +Y D+G L  +DGM D+
Sbjct: 121 IERIKKRVQETVVSGGQVRSDDNPGAFAKRLVEYREKTAPVSKFYSDIGLLKTVDGMADI 180

Query: 181 DEVSRSI 187
            +VSR+I
Sbjct: 181 SDVSRAI 187


>gi|319899078|ref|YP_004159171.1| adenylate kinase [Bartonella clarridgeiae 73]
 gi|319403042|emb|CBI76597.1| adenylate kinase [Bartonella clarridgeiae 73]
          Length = 197

 Score =  202 bits (514), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/197 (50%), Positives = 138/197 (70%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA  L+++ N+PQLSTGDMLR  + + T +GK  K  MESGSL+S
Sbjct: 1   MKVILLGPPGAGKGTQAKILTEEYNIPQLSTGDMLRVVIMKETEVGKIAKAVMESGSLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V DRI   DC +GFILDGYPRTV QA++L   + + +  +DAVIEL V++ ++
Sbjct: 61  DNIVNQIVSDRISESDCANGFILDGYPRTVVQAEALQQILKSKNEQLDAVIELVVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV + I S   VRSDD  D F KR+  YR+   P+S +Y D+G L  +DGM + 
Sbjct: 121 IERMKKRVQDTIVSGGQVRSDDNPDAFAKRLVEYREKTAPVSKFYLDIGLLKTVDGMANF 180

Query: 181 DEVSRSIDSLLVSVRKK 197
            +VSR+I + L  V +K
Sbjct: 181 SDVSRAIKNSLEGVFQK 197


>gi|319405877|emb|CBI79509.1| adenylate kinase [Bartonella sp. AR 15-3]
          Length = 192

 Score =  201 bits (512), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/191 (51%), Positives = 132/191 (69%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L+ + N+PQLSTGDMLRA + + T +GK  K  MESGSL+ 
Sbjct: 1   MRVILLGPPGAGKGTQAKILTDEYNIPQLSTGDMLRAVIMKETEVGKIAKAIMESGSLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V +RI   DC  GFILDGYPRTV QA++L   + + +  +DAVIEL V++ ++
Sbjct: 61  DNIVNQIVSERISESDCAGGFILDGYPRTVAQAEALQRILKSKNEQLDAVIELIVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV E + S + VRSDD    F KR+  YR+   P+S +Y D+G L  +DGM D+
Sbjct: 121 IERIKKRVQETVVSGEQVRSDDNPGAFAKRLVEYREKTAPVSKFYSDIGLLKTVDGMADV 180

Query: 181 DEVSRSIDSLL 191
             VSR+I  L 
Sbjct: 181 SGVSRAIKELF 191


>gi|121602066|ref|YP_989018.1| adenylate kinase [Bartonella bacilliformis KC583]
 gi|166980298|sp|A1USR5|KAD_BARBK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|120614243|gb|ABM44844.1| adenylate kinase [Bartonella bacilliformis KC583]
          Length = 192

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/191 (50%), Positives = 138/191 (72%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  L ++ N+ QLSTGDMLR  +++ T +GKQ K  +ESG+L+ 
Sbjct: 1   MRIILLGPPGAGKGTQARMLMERYNISQLSTGDMLREAIEKETEIGKQAKIFIESGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VNQ+V DRI   DC SGFILDGYPRTV QA++L   + + +  ++AVIEL V++ ++
Sbjct: 61  DFVVNQIVSDRIGEGDCVSGFILDGYPRTVGQAEALQRILQSKNMQLNAVIELIVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ RV E +A    +RSDD  D F KR+  YR+  +PLS +Y ++G L  +DGM D+
Sbjct: 121 IERIKKRVEEVVAVGGKIRSDDNPDSFAKRLLEYREKTVPLSKFYSNIGLLKTVDGMADI 180

Query: 181 DEVSRSIDSLL 191
            +VSR+I+++L
Sbjct: 181 ADVSRAINAIL 191


>gi|170738682|ref|YP_001767337.1| adenylate kinase [Methylobacterium sp. 4-46]
 gi|168192956|gb|ACA14903.1| adenylate kinase [Methylobacterium sp. 4-46]
          Length = 199

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 127/191 (66%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  +PQLSTGDMLRA V   T +G Q K  MESG L+ 
Sbjct: 1   MRIILLGPPGAGKGTQSARIVERFGIPQLSTGDMLRAAVAAGTPVGLQAKSIMESGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI  PD   GFILDG+PRTV QAK+L A ++     +DAVIE +V++A++
Sbjct: 61  DEVVIGIVGDRIEEPDARKGFILDGFPRTVAQAKALDALLAGKGLRLDAVIEFKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E +A  + VR DD  +VF  R++ YR    PLS YY   G L  IDGM  +
Sbjct: 121 VGRIANRAAETLARGEVVRKDDTPEVFKTRLDAYRSLTAPLSEYYAGTGLLRPIDGMAPI 180

Query: 181 DEVSRSIDSLL 191
           D+VSR I++LL
Sbjct: 181 DQVSREIEALL 191


>gi|195970178|ref|NP_385483.2| adenylate kinase [Sinorhizobium meliloti 1021]
 gi|307314380|ref|ZP_07593986.1| adenylate kinase [Sinorhizobium meliloti BL225C]
 gi|307322092|ref|ZP_07601468.1| adenylate kinase [Sinorhizobium meliloti AK83]
 gi|20138494|sp|Q93FE6|KAD_RHIME RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|16588799|gb|AAL26898.1| adenylate kinase [Sinorhizobium meliloti]
 gi|187904170|emb|CAC45956.2| Probable adenylate kinase [Sinorhizobium meliloti 1021]
 gi|306892274|gb|EFN23084.1| adenylate kinase [Sinorhizobium meliloti AK83]
 gi|306899078|gb|EFN29720.1| adenylate kinase [Sinorhizobium meliloti BL225C]
          Length = 192

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 133/191 (69%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA  L+++  +PQLSTGDMLR  V + T +GK+ K  M++G L+S
Sbjct: 1   MRLIFLGPPGAGKGTQAKLLTERYGIPQLSTGDMLRTAVAQATEVGKRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V DRI   DC  GFILDGYPRTV QA +L   +      +DAVIEL+V++A++
Sbjct: 61  DEIVNEIVSDRIDSADCARGFILDGYPRTVPQAVALDRMLEEKGLKLDAVIELKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E +A+  +VRSDD  + F +R++ YR+   PLS +Y   G L  +DGM D+
Sbjct: 121 VRRMENRVTETVAAGGTVRSDDNPEAFRRRLQEYREKTAPLSEHYARTGRLKTVDGMADV 180

Query: 181 DEVSRSIDSLL 191
             V+  I+ +L
Sbjct: 181 HTVTAEIEKIL 191


>gi|110634009|ref|YP_674217.1| adenylate kinase [Mesorhizobium sp. BNC1]
 gi|123057917|sp|Q11HS3|KAD_MESSB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|110284993|gb|ABG63052.1| Adenylate kinase [Chelativorans sp. BNC1]
          Length = 194

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L +KL++PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQILVEKLHIPQLSTGDMLRAAVKAETEIGKKAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIVN +V +RI  PDC +GFILDGYPRT+ QA ++ A +      +DAVIEL V+D ++
Sbjct: 61  DAIVNAIVAERIDQPDCANGFILDGYPRTLAQADAVEAMLGERGLKLDAVIELVVDDKAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  +A A+ + VR DD  +VF +R+  Y K   PL  YY   G L  +DGM  +
Sbjct: 121 VGRIMKRAEDAQAAGQPVRRDDNPEVFEERLREYYKKTAPLVGYYYAKGLLKGVDGMASI 180

Query: 181 DEVSRSIDSLL 191
           DEV+R I+ +L
Sbjct: 181 DEVTRQIEGIL 191


>gi|217976746|ref|YP_002360893.1| adenylate kinase [Methylocella silvestris BL2]
 gi|254806996|sp|B8ELE2|KAD_METSB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|217502122|gb|ACK49531.1| adenylate kinase [Methylocella silvestris BL2]
          Length = 193

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/192 (46%), Positives = 131/192 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++FLGPPG+GKGTQ+ RL QK N+PQLSTGDMLRA V   T +G + K  M++G L+ 
Sbjct: 1   MRLVFLGPPGAGKGTQSTRLQQKFNIPQLSTGDMLRAAVKAGTPVGLKAKAIMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD   GFILDG+PRTV QA++L   +   +  +DAVIEL+V+D ++
Sbjct: 61  DEVVVGIIADRIDEPDAKEGFILDGFPRTVKQAEALADILIKKNMKLDAVIELKVDDKAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI+ R  E++A  +++R+DD  + F KR+E+Y     P+S++Y   G L  +DGM  +
Sbjct: 121 LARIENRAQESLAKGETIRADDNPEAFKKRLESYHAQTAPVSAFYAGKGALKAVDGMAPI 180

Query: 181 DEVSRSIDSLLV 192
           D+VS +I+  L 
Sbjct: 181 DDVSAAIEKALA 192


>gi|49474383|ref|YP_032425.1| adenylate kinase [Bartonella quintana str. Toulouse]
 gi|68568770|sp|Q6FZE3|KAD_BARQU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|49239887|emb|CAF26285.1| Adenylate kinase [Bartonella quintana str. Toulouse]
          Length = 192

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 133/191 (69%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++FLGPPGSGKGTQA  L+++  +PQLSTGDMLR  + R T +G++ K  + +G+L+S
Sbjct: 1   MRVVFLGPPGSGKGTQARMLTEEYRIPQLSTGDMLREVISRETEVGRKAKAIINAGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+IVNQ+V +RI   DC +GF+LDGYPRTV QA+ L   + + +  +DAVIEL V++ ++
Sbjct: 61  DSIVNQIVSNRINESDCINGFVLDGYPRTVGQAEVLQQILQSKNMQLDAVIELIVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E IA    VRSDD +  F KR+  YR+   PLS +Y + G L ++DGM+ +
Sbjct: 121 IERMKKRVQETIAVGGQVRSDDNHVAFAKRLVEYREKTAPLSKFYSERGLLKVVDGMMAV 180

Query: 181 DEVSRSIDSLL 191
            EVSR I    
Sbjct: 181 TEVSRVIRGFF 191


>gi|218530412|ref|YP_002421228.1| adenylate kinase [Methylobacterium chloromethanicum CM4]
 gi|254806994|sp|B7L0S9|KAD_METC4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|218522715|gb|ACK83300.1| adenylate kinase [Methylobacterium chloromethanicum CM4]
          Length = 200

 Score =  197 bits (500), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  VPQLSTGDMLRA V   T +G + K  MESG L+S
Sbjct: 1   MRIILLGPPGAGKGTQSERIVERYRVPQLSTGDMLRAAVAAETPVGLEAKAIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV  +V DRI   D  +GFILDG+PRTV+QAK+L A ++    A+DAV+E  V++ ++
Sbjct: 61  DAIVVGIVADRIEEADAKNGFILDGFPRTVEQAKALDAMLAQKGIALDAVVEFVVDETAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E  A  + VR DD  +VF  R++ YRK   PLS YY   G L  IDGM  +
Sbjct: 121 VGRIAKRAEETAARGQPVRKDDTPEVFKTRLDAYRKQTAPLSDYYAGTGLLRKIDGMKPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           D V+  + +LL   R+  SS
Sbjct: 181 DVVTGDVTALLEGFRETASS 200


>gi|163851603|ref|YP_001639646.1| adenylate kinase [Methylobacterium extorquens PA1]
 gi|240138771|ref|YP_002963243.1| adenylate kinase [Methylobacterium extorquens AM1]
 gi|254561371|ref|YP_003068466.1| adenylate kinase [Methylobacterium extorquens DM4]
 gi|238687350|sp|A9W4R9|KAD_METEP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|163663208|gb|ABY30575.1| adenylate kinase [Methylobacterium extorquens PA1]
 gi|240008740|gb|ACS39966.1| adenylate kinase [Methylobacterium extorquens AM1]
 gi|254268649|emb|CAX24608.1| adenylate kinase [Methylobacterium extorquens DM4]
          Length = 200

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  VPQLSTGDMLRA V   T +G + K  MESG L+S
Sbjct: 1   MRIILLGPPGAGKGTQSERIVERYRVPQLSTGDMLRAAVAAETPVGLEAKAIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV  +V DRI   D  +GFILDG+PRTV+QAK+L A ++    A+DAV+E  V++ ++
Sbjct: 61  DAIVVGIVADRIEEADAKNGFILDGFPRTVEQAKALDAMLAQKGIALDAVVEFVVDETAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E  A  + VR DD  +VF  R++ YRK   PLS YY   G L  IDGM  +
Sbjct: 121 VGRIAKRAEETAARGQPVRKDDTPEVFKTRLDAYRKQTAPLSDYYAGTGLLRKIDGMKPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           D V+  + +LL   R+  SS
Sbjct: 181 DVVTGDVTALLDGFRETASS 200


>gi|170748615|ref|YP_001754875.1| adenylate kinase [Methylobacterium radiotolerans JCM 2831]
 gi|238688766|sp|B1LWQ5|KAD_METRJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|170655137|gb|ACB24192.1| adenylate kinase [Methylobacterium radiotolerans JCM 2831]
          Length = 200

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 134/200 (67%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ Q+  +PQLSTGDMLRA V   T +G + K  MESG L+S
Sbjct: 1   MRIILLGPPGAGKGTQSERIVQRFGIPQLSTGDMLRAAVAAGTPVGLEAKAVMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V DRI  PD   GFILDG+PRTV QA++L   +++   ++ AV+EL+V++ ++
Sbjct: 61  DRIVVGIVADRIEEPDARRGFILDGFPRTVAQAEALGEMLASKGLSLSAVVELKVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI+ R  E +A  ++VR DD  +VF +R+E YR    PLS+YY   G L  +DGM  +
Sbjct: 121 VGRIEKRAAETLARGQAVRKDDTPEVFKQRLEAYRAQTAPLSAYYAQKGTLETVDGMQPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           D+V+  + ++L    ++ +S
Sbjct: 181 DKVTADLMAVLEPHEERVAS 200


>gi|220921920|ref|YP_002497221.1| adenylate kinase [Methylobacterium nodulans ORS 2060]
 gi|254806995|sp|B8IT32|KAD_METNO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|219946526|gb|ACL56918.1| adenylate kinase [Methylobacterium nodulans ORS 2060]
          Length = 199

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 127/191 (66%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  +PQLSTGDMLRA V   T +G Q K  MESG L+ 
Sbjct: 1   MRIILLGPPGAGKGTQSARIVEQFGIPQLSTGDMLRAAVAARTPVGLQAKSIMESGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI   D   GFILDG+PRTV QAK+L A ++    ++DAVIE RV++ ++
Sbjct: 61  DEVVVGIVADRIDEADARKGFILDGFPRTVAQAKALDAMLAAKGLSLDAVIEFRVDEEAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E +A  ++VR DD  +VF  R++ YR    P+S YY   G L  IDGM  +
Sbjct: 121 LGRIAKRAAETLARGEAVRKDDTPEVFKTRLDAYRSQTAPVSDYYAQTGLLRPIDGMAPI 180

Query: 181 DEVSRSIDSLL 191
           D+VSR+++ LL
Sbjct: 181 DDVSRAVEVLL 191


>gi|23012203|ref|ZP_00052347.1| COG0563: Adenylate kinase and related kinases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 200

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 130/200 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  VPQLSTGDMLRA V   T +G + K  MESG L+ 
Sbjct: 1   MRIILLGPPGAGKGTQSERIVERYRVPQLSTGDMLRAAVAAETPVGLEAKSIMESGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA+V  +V DRI   D  +GFILDG+PRTV+QAK+L A ++    A+DAV+E  V++ ++
Sbjct: 61  DAVVVGIVADRIEEADAKNGFILDGFPRTVEQAKALDAMLAEKGIALDAVVEFVVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E  A  + VR DD  +VF  R++ Y+K   PLS YY   G L  +DGM  +
Sbjct: 121 VGRIAKRAEETAARGQPVRKDDTPEVFKTRLDAYKKQTAPLSDYYAGTGLLRKVDGMKPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           DEV+  +  LL   R+K +S
Sbjct: 181 DEVTGDLTGLLDGFREKAAS 200


>gi|188581395|ref|YP_001924840.1| adenylate kinase [Methylobacterium populi BJ001]
 gi|238692867|sp|B1Z772|KAD_METPB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|179344893|gb|ACB80305.1| adenylate kinase [Methylobacterium populi BJ001]
          Length = 200

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 129/200 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQ+ R+ ++  VPQLSTGDMLRA V   T +G + K  MESG L+ 
Sbjct: 1   MRIILLGPPGAGKGTQSERIVERYRVPQLSTGDMLRAAVAAGTPVGLEAKSIMESGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA+V  +V DRI   D   GFILDG+PRTV+QAK+L A ++    A+DAV+E  V++ ++
Sbjct: 61  DAVVVGIVADRIEEADARDGFILDGFPRTVEQAKALDAMLAEKGIALDAVVEFVVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E  A  + VR DD  +VF  R++ Y++   PLS YY   G L  IDGM  +
Sbjct: 121 VGRIAKRAEETAARGQPVRKDDTPEVFKTRLDAYKRQTAPLSDYYAGTGLLRKIDGMKPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           DEV+  +  LL   R+K +S
Sbjct: 181 DEVTGDVTGLLDGFREKATS 200


>gi|323136107|ref|ZP_08071190.1| adenylate kinase [Methylocystis sp. ATCC 49242]
 gi|322399198|gb|EFY01717.1| adenylate kinase [Methylocystis sp. ATCC 49242]
          Length = 193

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 131/191 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQA RL +KL VPQLSTGDMLRA V   T +G + K  M++G L+ 
Sbjct: 1   MRIVLLGPPGAGKGTQATRLIEKLGVPQLSTGDMLRAAVAAGTPIGLKAKAIMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++  RI  PDC +GFILDG+PRTV QA++L A ++     +DAVIEL V++ ++
Sbjct: 61  DDVVVGIIDQRIDAPDCATGFILDGFPRTVAQAEALRAMLATKGLKLDAVIELVVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E IA+  +VR+DD  + F  R+E YR    P+S++Y + G L  +DGM  +
Sbjct: 121 VDRMRKRVAETIAAGGTVRADDNPESFKTRLETYRAQTAPVSAHYAERGDLKQVDGMRSI 180

Query: 181 DEVSRSIDSLL 191
           DEV+ +I + L
Sbjct: 181 DEVTAAIGTAL 191


>gi|319783341|ref|YP_004142817.1| adenylate kinase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169229|gb|ADV12767.1| adenylate kinase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 198

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 127/191 (66%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVEKHGIPQLSTGDMLRAAVQAGTEVGKRAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIVN +V +RI  PDC  GFILDGYPRT+ QA ++   +S+    +DAVIEL V+D ++
Sbjct: 61  DAIVNAIVAERIDQPDCAKGFILDGYPRTLVQADAVEQMLSDRSQGLDAVIELVVDDKAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A+   VR DD   VF +R+  Y K   PL  YY   G L  +DGM D+
Sbjct: 121 VGRIVKRADEAQAAGLPVRKDDNPTVFEERLREYYKKTSPLIGYYYAKGKLRSVDGMADI 180

Query: 181 DEVSRSIDSLL 191
           D V+  I+++L
Sbjct: 181 DAVTEQIEAVL 191


>gi|182678358|ref|YP_001832504.1| adenylate kinase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|238691241|sp|B2IK83|KAD_BEII9 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|182634241|gb|ACB95015.1| adenylate kinase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 193

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 128/191 (67%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQ+ RL ++  +PQLSTGDMLRA V   T +G + K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQSERLREQCKIPQLSTGDMLRAAVKAGTPIGLKAKAVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V DRI  PD  +GFILDG+PRTV QA++L   +      +DAVIEL V++ ++
Sbjct: 61  DDIVVGIVADRIEEPDARNGFILDGFPRTVKQAEALTTMLHEKKMDLDAVIELVVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI+ R  E +A+  +VR+DD    F  RI+ YR+   P+S+YY   G L  +DGM D+
Sbjct: 121 LARIEKRAKETLAAGGTVRADDNPAAFKTRIDTYREQTAPVSAYYASQGVLKTVDGMADI 180

Query: 181 DEVSRSIDSLL 191
           D V+ +ID +L
Sbjct: 181 DTVTAAIDKIL 191


>gi|163868629|ref|YP_001609838.1| adenylate kinase [Bartonella tribocorum CIP 105476]
 gi|189046005|sp|A9IVZ9|KAD_BART1 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|161018285|emb|CAK01843.1| adenylate kinase [Bartonella tribocorum CIP 105476]
          Length = 192

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  L+++ N+P LSTGDMLR  + + T +GK+ K  + SG+L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAKMLTEEYNIPHLSTGDMLREVIAKETEVGKKAKAIISSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+IVNQ+V DRI   DC +GFILDGYPRTV QA++L   + + +  +DAVIEL V + ++
Sbjct: 61  DSIVNQIVSDRIDEADCINGFILDGYPRTVGQAEALQQILESKNMRLDAVIELCVNEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E +A+   VR DD    F KR+  YR+   PLS +Y + G L +IDGM+ +
Sbjct: 121 IERMERRVQETVAAGGQVRLDDNPVAFAKRLVEYREKTSPLSKFYSERGMLKVIDGMIGI 180

Query: 181 DEVSRSIDSLL 191
            EV+R I   L
Sbjct: 181 AEVTRIIKGFL 191


>gi|240850814|ref|YP_002972214.1| adenylate kinase [Bartonella grahamii as4aup]
 gi|240267937|gb|ACS51525.1| adenylate kinase [Bartonella grahamii as4aup]
          Length = 192

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 130/191 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L+++ N+P LSTGDMLR  + + T +GK+ K  + SG+L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAKMLTEEYNIPHLSTGDMLREVIAKETEIGKKAKAIISSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V DRI   DC +GF+LDGYPRTV QA++L   + + +  +DAVIEL V++  +
Sbjct: 61  DNIVNQIVSDRIDETDCVNGFVLDGYPRTVGQAEALQQILQSKNMRLDAVIELCVDEDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E IA+   VR DD    F KR+  YR+   PLS +Y + G L +IDGM+ +
Sbjct: 121 IERMKKRVEETIAAGGQVRLDDNPVAFAKRLVEYREKTAPLSKFYSERGMLKVIDGMIGI 180

Query: 181 DEVSRSIDSLL 191
            EV+R I   L
Sbjct: 181 TEVTRMIRGFL 191


>gi|319408744|emb|CBI82401.1| adenylate kinase [Bartonella schoenbuchensis R1]
          Length = 192

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 128/191 (67%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA  L +  N+PQLSTGDMLR  V     +GK+ K  +ESG+L+S
Sbjct: 1   MRVIFLGPPGAGKGTQAKILGEHYNIPQLSTGDMLREAVIAEKEIGKKAKAIIESGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V DRI   DC +GFILDGYPRTV QA++L   + + +  ++AVIE  V++ ++
Sbjct: 61  DDIVNQIVSDRIDENDCVNGFILDGYPRTVGQAEALQQILQSKNVQLNAVIEFIVDEKAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E IA    VRSDD  D F KR+  YR+   PLS +Y   G L  +DGM  +
Sbjct: 121 IERMKKRVEETIAVGGQVRSDDNSDSFAKRLVEYREKTAPLSEFYLKTGLLKKVDGMAGV 180

Query: 181 DEVSRSIDSLL 191
            ++S +I   L
Sbjct: 181 TDISCAIREFL 191


>gi|146340078|ref|YP_001205126.1| adenylate kinase [Bradyrhizobium sp. ORS278]
 gi|146192884|emb|CAL76889.1| Adenylate kinase [Bradyrhizobium sp. ORS278]
          Length = 293

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/200 (46%), Positives = 127/200 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPGSGKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M +G L+ 
Sbjct: 1   MRLILLGPPGSGKGTQAQRLVQQYGIVQLSTGDMLRAAVAAQTPIGLKAKDIMAAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +GFILDG+PRTV QA++L A +      +DAVIELRV +  +
Sbjct: 61  DEVVVGIIADRIEQPDAANGFILDGFPRTVPQAEALDALLKQKQMNLDAVIELRVNEGVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R  E  A  ++VR+DD  +V  KR+ +YR    PL  YY D   L  +DGM+ +
Sbjct: 121 LERVERRAAETRARGEAVRADDTPEVLTKRLHSYRDQTEPLIHYYSDHRMLATVDGMMPI 180

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           +EV+  I  +L +V K   S
Sbjct: 181 EEVTEEIGRILAAVGKSAGS 200


>gi|49475773|ref|YP_033814.1| adenylate kinase [Bartonella henselae str. Houston-1]
 gi|68568771|sp|Q6G2Y6|KAD_BARHE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|49238580|emb|CAF27821.1| Adenylate kinase [Bartonella henselae str. Houston-1]
          Length = 192

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 131/191 (68%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQA  L ++ ++PQLSTGDMLR  + R T +GK+ K  + +G+L+S
Sbjct: 1   MRIVLLGPPGAGKGTQAKMLCEEYHIPQLSTGDMLREVIRRETEIGKKAKAMINAGTLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+IVNQ+V DRI   DC +GF+LDGYPRTV QA+ L   + + +  +DAVIEL V++ ++
Sbjct: 61  DSIVNQIVSDRIDESDCINGFVLDGYPRTVGQAEVLQQVLQSKNMQLDAVIELIVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E I +   VRSDD    F KR+  YR+   PLS +Y     L ++DGM+ +
Sbjct: 121 LERMKKRVQETIIAGGQVRSDDNPVAFAKRLVEYREKTAPLSEFYLQRRLLKLVDGMIGV 180

Query: 181 DEVSRSIDSLL 191
            EVSR I  +L
Sbjct: 181 TEVSRKIREVL 191


>gi|13470572|ref|NP_102141.1| adenylate kinase [Mesorhizobium loti MAFF303099]
 gi|20138506|sp|Q98N36|KAD_RHILO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|14021314|dbj|BAB47927.1| adenylate kinase [Mesorhizobium loti MAFF303099]
          Length = 198

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 127/193 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL +K  +PQLSTGDMLRA V   + +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVEKHGIPQLSTGDMLRAAVQAGSEVGKRAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIVN +V +RI   DC  GFILDGYPRT+ QA ++ + +S     +D VIEL V+D ++
Sbjct: 61  DAIVNAIVAERIDQADCAKGFILDGYPRTLVQADAVESMLSERGIGLDTVIELVVDDRAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  +A A+ + VR DD   VF +R+  Y K   PL+ YY   G L  +DG+  +
Sbjct: 121 VGRIVKRAEDAKAAGQPVRKDDNPAVFEERLREYYKKTAPLTGYYYAKGKLKTVDGLASI 180

Query: 181 DEVSRSIDSLLVS 193
           D V+  I+++L +
Sbjct: 181 DAVTNEIEAVLTA 193


>gi|148256371|ref|YP_001240956.1| adenylate kinase [Bradyrhizobium sp. BTAi1]
 gi|146408544|gb|ABQ37050.1| Adenylate kinase [Bradyrhizobium sp. BTAi1]
          Length = 309

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 127/200 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPGSGKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M +G L+ 
Sbjct: 8   MRLILLGPPGSGKGTQAQRLVQQYGIVQLSTGDMLRAAVAAQTPIGLKAKDIMAAGGLVP 67

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +GFILDG+PRTV QA++L A +      +DAVIEL+V +  +
Sbjct: 68  DEVVVGIIADRIEQPDAANGFILDGFPRTVPQAEALDALLKQKQMTLDAVIELKVNEGVL 127

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R  E  A  + VR+DD  +V  KR+ +YR    PL  YY D   L  +DGM+ +
Sbjct: 128 LERVERRAAETRARGEPVRADDTPEVLTKRLASYRDQTEPLIHYYSDHRMLATVDGMMPI 187

Query: 181 DEVSRSIDSLLVSVRKKCSS 200
           ++V+  I  +L +V K  +S
Sbjct: 188 EQVTAEIGRILAAVGKGGTS 207


>gi|304321461|ref|YP_003855104.1| adenylate kinase [Parvularcula bermudensis HTCC2503]
 gi|303300363|gb|ADM09962.1| adenylate kinase [Parvularcula bermudensis HTCC2503]
          Length = 195

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/194 (45%), Positives = 127/194 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLGPPG+GKGTQA  +++   +PQLSTGDMLRA +   T +G Q K  +E G L+S
Sbjct: 1   MIVIFLGPPGAGKGTQAAYIAKSRGIPQLSTGDMLRAAIKAETPVGLQAKAIIERGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI  PDC  GF+LDG+PRT+ QA+ L   +    C ID V+EL+V++ ++
Sbjct: 61  DDVVAGIVAERIDAPDCKPGFLLDGFPRTLGQAQMLDDIVKTKSCDIDVVLELKVDEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R+ E  A  + VRSDD  + F  R+E YR+   PL  +Y++ G L  IDGM  +
Sbjct: 121 VDRLRTRIEETKARGEPVRSDDNEEAFRNRLEVYREQTAPLIPFYKEKGLLREIDGMQPI 180

Query: 181 DEVSRSIDSLLVSV 194
           D+VS  ID +L S+
Sbjct: 181 DQVSAEIDKVLDSL 194


>gi|86749436|ref|YP_485932.1| adenylate kinase [Rhodopseudomonas palustris HaA2]
 gi|86572464|gb|ABD07021.1| Adenylate kinase [Rhodopseudomonas palustris HaA2]
          Length = 341

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 122/191 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAARLVQQYGLVQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +GFILDG+PRTV QA++L A + +    +DAV+ELRV ++++
Sbjct: 61  DEVVIGIISDRIEQPDATNGFILDGFPRTVPQAEALDALLKDKKLGLDAVVELRVNESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E     +  R+DD  +   KR+  YR    PL  YY D   L  +DGM+ +
Sbjct: 121 LARVETRVAEMRERGEEPRADDNAEALAKRLTAYRLQTEPLVEYYSDKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLL 191
           DEV+R I  +L
Sbjct: 181 DEVTREIGRIL 191


>gi|260468533|ref|ZP_05813700.1| adenylate kinase [Mesorhizobium opportunistum WSM2075]
 gi|259028689|gb|EEW29998.1| adenylate kinase [Mesorhizobium opportunistum WSM2075]
          Length = 202

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 122/188 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVEKHGIPQLSTGDMLRAAVQAGTEVGKRAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIVN +V +RI   +C  GFILDGYPRT+ QA ++   ++     +D VIEL V+D ++
Sbjct: 61  DAIVNAIVAERIDQANCAKGFILDGYPRTLVQADAVEQMLAERGIGLDTVIELVVDDRAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  +A A+ + VR DD   VF +R+  Y K   PL+ YY   G L  +DGM  +
Sbjct: 121 VGRIVKRAEDAKAAGQPVRKDDNPAVFEERLREYYKKTAPLTGYYYAKGRLKTVDGMASI 180

Query: 181 DEVSRSID 188
           D V+  I+
Sbjct: 181 DAVTAEIE 188


>gi|296447551|ref|ZP_06889473.1| adenylate kinase [Methylosinus trichosporium OB3b]
 gi|296254939|gb|EFH02044.1| adenylate kinase [Methylosinus trichosporium OB3b]
          Length = 200

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 127/198 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQ+ RL  K  +PQLSTGDMLRA V+  + +G Q K  M+SG+L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQSARLVAKYAIPQLSTGDMLRAAVEARSPIGLQAKEIMDSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++  RI+  D   GFILDG+PRTV QA++L   ++     +DAVIEL V++ ++
Sbjct: 61  DEVVVGIIGQRIKEKDAARGFILDGFPRTVAQARALDELLAREGQRLDAVIELSVDENAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+Q RV E IA+   VR DD    F  R+E YR    P+S YY + G L  +DGM  +
Sbjct: 121 LARMQKRVAETIANGGCVRGDDNPQAFKTRLEAYRSQTAPVSHYYAEKGELNQVDGMKAV 180

Query: 181 DEVSRSIDSLLVSVRKKC 198
           + VS +ID+ L +  +K 
Sbjct: 181 EAVSAAIDAALTTGERKA 198


>gi|90424916|ref|YP_533286.1| adenylate kinase [Rhodopseudomonas palustris BisB18]
 gi|90106930|gb|ABD88967.1| Adenylate kinase [Rhodopseudomonas palustris BisB18]
          Length = 335

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/195 (45%), Positives = 129/195 (66%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M SG+L+ 
Sbjct: 1   MRLILLGPPGAGKGTQALRLVQRYGIVQLSTGDMLRAAVKAQTPIGLKAKDIMASGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR+  PD  +GFILDG+PRTV QA++L   +      +DAV+ELRV + ++
Sbjct: 61  DEVVVGIISDRLDQPDAANGFILDGFPRTVPQAEALDLLLKAKQLKLDAVVELRVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  ++VR+DD  +V  KR+ +YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LARVETRVAEMQARGEAVRADDTPEVLSKRLASYRSQTEPLIHYYSEQRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLLVSVR 195
           +EV++ ID +L ++R
Sbjct: 181 EEVTKEIDRVLAAIR 195


>gi|115525564|ref|YP_782475.1| adenylate kinase [Rhodopseudomonas palustris BisA53]
 gi|115519511|gb|ABJ07495.1| Adenylate kinase [Rhodopseudomonas palustris BisA53]
          Length = 356

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 126/194 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL ++  + QLSTGDMLRA V   T +G + K  M SG+L+ 
Sbjct: 1   MRLILLGPPGAGKGTQALRLVERHGIVQLSTGDMLRAAVAAETPVGLKAKDLMASGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR+   D  +GFILDG+PRTV QA++L A +     A+DAV+EL+V + ++
Sbjct: 61  DEVVIGIISDRLEQDDAANGFILDGFPRTVPQAEALDALLKEKGIALDAVVELKVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  +  R DD  +   KR+ +YR +  PL  YY +   L  +DGM+ +
Sbjct: 121 LARVENRVAEMRARGEEPRPDDNAEALAKRLSSYRASTEPLVDYYSEKRKLLTVDGMMSI 180

Query: 181 DEVSRSIDSLLVSV 194
           DEV++ ID +L ++
Sbjct: 181 DEVTKEIDRVLSAI 194


>gi|83593999|ref|YP_427751.1| adenylate kinase [Rhodospirillum rubrum ATCC 11170]
 gi|83576913|gb|ABC23464.1| Adenylate kinase [Rhodospirillum rubrum ATCC 11170]
          Length = 195

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 128/190 (67%), Gaps = 2/190 (1%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IF+GPPG GKGTQA RL +K  + QLSTGDMLRA V   T LG+Q K  +++G L+SD
Sbjct: 5   RVIFMGPPGGGKGTQAQRLEKKYQLKQLSTGDMLRAAVAAGTDLGRQAKAIIDAGKLVSD 64

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            I+  ++ +RI   DC +GF+LDG+PRTV QA++L   +++    +DAVIELRV+D+ +F
Sbjct: 65  DIMVGMIAERIDETDCANGFVLDGFPRTVPQAEALDVMLADKGLKLDAVIELRVDDSILF 124

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            RI+ R  EA A   SVR+DD  D   KR++ Y     P+  YY   G L+++DG L +D
Sbjct: 125 DRIRKRAAEADAG--SVRADDNEDTLRKRLDIYHGMTAPILPYYGQKGLLHVVDGTLPVD 182

Query: 182 EVSRSIDSLL 191
            V+R ++ +L
Sbjct: 183 AVTRELEGIL 192


>gi|85715109|ref|ZP_01046093.1| adenylate kinase [Nitrobacter sp. Nb-311A]
 gi|85698024|gb|EAQ35897.1| adenylate kinase [Nitrobacter sp. Nb-311A]
          Length = 211

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 128/191 (67%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+IFLGPPG+GKGTQA RL +   + QLSTGDMLRA V   T +G + K  M SG L+ 
Sbjct: 6   MRLIFLGPPGAGKGTQAQRLVRHYGIIQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVP 65

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR+   D   GFILDG+PRTV QA++L   + + +  +DAV+ELRV+++++
Sbjct: 66  DDVVIGIISDRLEQADAKMGFILDGFPRTVPQAEALDRLLQSKNLVLDAVVELRVDESAL 125

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E  A  + VR+DD+ +V  KR+ +YR    PL  YY + G L  +DGM+ +
Sbjct: 126 LQRVESRVAEMTARGEQVRADDRPEVLAKRLASYRALTEPLIRYYSERGKLLTVDGMMAI 185

Query: 181 DEVSRSIDSLL 191
           D+V+R I  +L
Sbjct: 186 DDVTRDIRRVL 196


>gi|158424157|ref|YP_001525449.1| adenylate kinase [Azorhizobium caulinodans ORS 571]
 gi|172047976|sp|A8IAP0|KAD_AZOC5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|158331046|dbj|BAF88531.1| subfamily adenylate kinase [Azorhizobium caulinodans ORS 571]
          Length = 194

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 125/191 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  MESG L+S
Sbjct: 1   MRLVLLGPPGAGKGTQALRLVQRHGIVQLSTGDMLRAAVAAGTPVGLKAKAVMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+  PD   GFILDG+PRTV QA +L   +++    +DAVIEL+V+ A +
Sbjct: 61  DEIVIGIIAERLDQPDARKGFILDGFPRTVAQADALDKLLADKGLKLDAVIELKVDQAKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A  + VR DD  +VF  R+E Y +    ++ YY   G L  IDGM  +
Sbjct: 121 LDRILNRAAEAKAKGEPVRKDDDPEVFKTRLEAYNRDTAVVAPYYSARGQLQQIDGMAPI 180

Query: 181 DEVSRSIDSLL 191
           ++V+++IDS+L
Sbjct: 181 EKVTQAIDSIL 191


>gi|209884834|ref|YP_002288691.1| adenylate kinase [Oligotropha carboxidovorans OM5]
 gi|209873030|gb|ACI92826.1| adenylate kinase [Oligotropha carboxidovorans OM5]
          Length = 350

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 124/194 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T  G   K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVQRHGIVQLSTGDMLRAAVAAETPTGLIAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D   GFILDG+PRTV QA++L   +      +DAV+ELRV + ++
Sbjct: 61  DEVVVGIIADRIEQDDAKGGFILDGFPRTVAQAEALDELLKKKKLKLDAVVELRVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R+ E  A  ++VR+DD  +V  KR+ NYR+   PL  YY D   L  +DGM+ +
Sbjct: 121 LARVENRIAEMRARGENVRADDTPEVLAKRLANYREQTEPLVHYYADKRALVTVDGMMPI 180

Query: 181 DEVSRSIDSLLVSV 194
           +EV+ +I+ +L ++
Sbjct: 181 EEVTGAIERVLSAI 194


>gi|307946307|ref|ZP_07661642.1| adenylate kinase [Roseibium sp. TrichSKD4]
 gi|307769971|gb|EFO29197.1| adenylate kinase [Roseibium sp. TrichSKD4]
          Length = 197

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 123/191 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA RL    N+PQLSTGDMLRA V   T +G Q K  M++G L+S
Sbjct: 1   MRLILVGPPGAGKGTQAARLVANYNIPQLSTGDMLRAAVAAETPIGLQAKAVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DRI   D  +GFILDG+PRT+ QA +L   + +    ++AV+ELRV+   +
Sbjct: 61  DEIVVGIIRDRINEEDAKNGFILDGFPRTIAQADALADMLKDNGLELNAVVELRVDQTKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A+ + VR DD  +VF  R+E Y +    +  YY   G L ++DGM  +
Sbjct: 121 VDRIINRAEEAKAAGQPVRKDDDPEVFKDRLEAYNRDTAVVIPYYEKAGLLTVVDGMQSI 180

Query: 181 DEVSRSIDSLL 191
           D+V+ SID++L
Sbjct: 181 DDVAGSIDAVL 191


>gi|75675577|ref|YP_317998.1| adenylate kinase [Nitrobacter winogradskyi Nb-255]
 gi|123613568|sp|Q3SSU5|KAD_NITWN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|74420447|gb|ABA04646.1| Adenylate kinase [Nitrobacter winogradskyi Nb-255]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 126/191 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVHHYGIIQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR+   D   GFILDG+PRTV QA++L   + + + A+DAVIELRV+++++
Sbjct: 61  DDVVIGIISDRLEQADAKDGFILDGFPRTVPQAEALDILLQSKNLALDAVIELRVDESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E  A  + VR+DD  +V  +R+ +YR    PL  YY + G L  +DGM+ +
Sbjct: 121 LQRVENRVAETTARGEQVRADDNPEVLSQRLASYRALTEPLIRYYSERGRLLTVDGMMAI 180

Query: 181 DEVSRSIDSLL 191
           D+V+R I  +L
Sbjct: 181 DDVTRDIRRVL 191


>gi|91977631|ref|YP_570290.1| adenylate kinase [Rhodopseudomonas palustris BisB5]
 gi|91684087|gb|ABE40389.1| Adenylate kinase [Rhodopseudomonas palustris BisB5]
          Length = 360

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (62%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAARLVQQYGIVQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D  +GFILDG+PRTV QA++L   + +    +DAV+ELRV ++++
Sbjct: 61  DEVVIGIISDRIEQSDAANGFILDGFPRTVPQAEALDRLLKDKRIGLDAVVELRVNESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E     +  R+DD  +   KR+  YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LARVETRVAEMRERGEEPRADDNAEALSKRLSAYRAQTEPLVEYYSEKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLL 191
           DEV+R I  +L
Sbjct: 181 DEVTREIGRIL 191


>gi|298291459|ref|YP_003693398.1| adenylate kinase [Starkeya novella DSM 506]
 gi|296927970|gb|ADH88779.1| adenylate kinase [Starkeya novella DSM 506]
          Length = 194

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 124/194 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL  +  + QLSTGDMLR  V   T +G + K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVARHGIVQLSTGDMLREAVRNGTPVGLRAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DRI  PDC  GFILDG+PRTV QA++L + ++     +DAVIEL+V+ A +
Sbjct: 61  DDIVIGIISDRIDQPDCSKGFILDGFPRTVAQAEALDSILAEKGLKLDAVIELKVDQAKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E  A  + VR DD   VF  R+E Y +    ++ YY + G L  IDGM  +
Sbjct: 121 VDRILQRARETAARGEPVRKDDDPVVFKTRLEAYNRDTAVVAPYYAERGLLVAIDGMRPI 180

Query: 181 DEVSRSIDSLLVSV 194
           DEV+++I  +L +V
Sbjct: 181 DEVTQAISDVLETV 194


>gi|27380490|ref|NP_772019.1| adenylate kinase [Bradyrhizobium japonicum USDA 110]
 gi|27353654|dbj|BAC50644.1| bll5379 [Bradyrhizobium japonicum USDA 110]
          Length = 297

 Score =  175 bits (443), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 124/194 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPGSGKGTQA  L ++  + QLSTG+MLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRIILLGPPGSGKGTQAQLLVERYGIVQLSTGEMLRAAVAAGTPVGLKAKEIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +GFILDG+PRTV QA++L   +      +DAVIELRV ++++
Sbjct: 61  DDVVVGIISDRIDQPDAKNGFILDGFPRTVPQAEALDELLRQKHLKLDAVIELRVNESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV +     + VR DD  +V  KR+ +YR    PL  YY +   L  IDGM+ +
Sbjct: 121 LSRVETRVAQMRERGEEVRLDDTPEVLTKRLASYRSQTEPLIHYYSERRKLSTIDGMMAI 180

Query: 181 DEVSRSIDSLLVSV 194
           DEV+R++   L+++
Sbjct: 181 DEVTRAVHRQLLAL 194


>gi|300022562|ref|YP_003755173.1| adenylate kinase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524383|gb|ADJ22852.1| adenylate kinase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 197

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++ LGPPG+GKGTQ+ ++S+KL +PQLSTGDMLRA V   T +G + K  M SG L+S
Sbjct: 1   MILMLLGPPGAGKGTQSQQISEKLGIPQLSTGDMLRAAVKAETPVGLKAKQVMASGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DRI   DC  GFILDG+PRT+ QA +L   + +    ID VIEL+V+D  +
Sbjct: 61  DEIVIGIIADRISEADCSKGFILDGFPRTLAQADALDKLLKSKGRKIDCVIELKVDDGKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI+ R  E +A+  +VR+DD  +    R+  Y +   P+  YY   G L  IDGM  +
Sbjct: 121 VDRIENRARETLAAGGTVRADDNAEALKTRLMAYYRETAPIIGYYFAHGLLKSIDGMAPI 180

Query: 181 DEVSRSIDSLL 191
            EVS+ ID +L
Sbjct: 181 AEVSQQIDEIL 191


>gi|299135236|ref|ZP_07028427.1| adenylate kinase [Afipia sp. 1NLS2]
 gi|298590213|gb|EFI50417.1| adenylate kinase [Afipia sp. 1NLS2]
          Length = 322

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 127/196 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T  G   K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVQRHGIVQLSTGDMLRAAVAAQTPTGLIAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D  +GFILDG+PRTV QA++L A +      +DAVIELRV ++++
Sbjct: 61  DEVVVSIIADRIEQDDAKNGFILDGFPRTVPQAEALDALLKKKKLKLDAVIELRVNESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E +   +SVR+DD  +V  KR+ NYR+   PL  +Y D   L  IDGM+ +
Sbjct: 121 LARVEKRVAEMLERGESVRADDTPEVLSKRLANYREQTEPLVHHYSDKRKLITIDGMMPI 180

Query: 181 DEVSRSIDSLLVSVRK 196
           +EV+  I+ +L +V K
Sbjct: 181 EEVTAEIERVLAAVTK 196


>gi|154253198|ref|YP_001414022.1| adenylate kinase [Parvibaculum lavamentivorans DS-1]
 gi|171769643|sp|A7HWT2|KAD_PARL1 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|154157148|gb|ABS64365.1| adenylate kinase [Parvibaculum lavamentivorans DS-1]
          Length = 205

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 125/199 (62%), Gaps = 3/199 (1%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA RL +   + QLSTGDMLRA V + + +GK  +G M  G L+ 
Sbjct: 1   MKLILLGPPGAGKGTQAKRLEEAHGLVQLSTGDMLRAAVAQGSEVGKVAEGIMARGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +G+ILDG+PR V QA++L   ++     +DAV+EL V+D+ +
Sbjct: 61  DDVVVGIIADRIEQPDAVNGYILDGFPRNVAQAEALDKMLAGKGTTLDAVVELGVDDSIL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KRI+ R  E        R+DD  +   KR++ Y +   PL +YY+  G L  +DGM  M
Sbjct: 121 LKRIETRAAETAGGP---RADDNAEALAKRLKVYHEQTAPLIAYYKAKGKLRTVDGMKSM 177

Query: 181 DEVSRSIDSLLVSVRKKCS 199
           DEV+  I+++L   ++K S
Sbjct: 178 DEVTGQIETVLGISKRKGS 196


>gi|39936292|ref|NP_948568.1| adenylate kinase [Rhodopseudomonas palustris CGA009]
 gi|39650147|emb|CAE28670.1| Adenylate kinase [Rhodopseudomonas palustris CGA009]
          Length = 371

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 122/195 (62%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL ++  + QLSTGDMLRA V   T +G + K  M +G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAGRLVEQHGIVQLSTGDMLRAAVAAGTPIGLKAKDIMAAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D   GFILDG+PRTV QA++L   + +    +DAV+EL+V + ++
Sbjct: 61  DEVVIGIISDRIDQDDAAQGFILDGFPRTVPQAEALDRLLKDKGFDLDAVVELKVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  +  R+DD  +   KR+  YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEPLVDYYSEKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLLVSVR 195
           DEV+R I  +L +VR
Sbjct: 181 DEVTREIGRVLDAVR 195


>gi|192292016|ref|YP_001992621.1| adenylate kinase [Rhodopseudomonas palustris TIE-1]
 gi|192285765|gb|ACF02146.1| adenylate kinase [Rhodopseudomonas palustris TIE-1]
          Length = 367

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 121/195 (62%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL ++  + QLSTGDMLRA V   T +G + K  M +G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAGRLVEQHGIVQLSTGDMLRAAVAAGTPVGLKAKDIMAAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D   GFILDG+PRTV QA++L   + +    +DAV+EL+V + ++
Sbjct: 61  DEVVIGIISDRIDQDDAAQGFILDGFPRTVPQAEALDRLLKDKGFDLDAVVELKVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  +  R+DD  +   KR+  YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEPLVDYYSEKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLLVSVR 195
           DEV+R I   L +VR
Sbjct: 181 DEVTREIGRGLDAVR 195


>gi|316933548|ref|YP_004108530.1| adenylate kinase [Rhodopseudomonas palustris DX-1]
 gi|315601262|gb|ADU43797.1| adenylate kinase [Rhodopseudomonas palustris DX-1]
          Length = 379

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 121/194 (62%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL ++  + QLSTGDMLRA V   T +G + K  M +G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQASRLVEQHGIVQLSTGDMLRAAVAAGTPIGLKAKDIMAAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   D   GFILDG+PRTV QA++L   + +    +DAV+EL+V + ++
Sbjct: 61  DEVVIGIISDRIDQDDAAQGFILDGFPRTVPQAEALDRLLGDKGFDLDAVVELKVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  +  R+DD  +   KR+  YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEPLVDYYSEKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLLVSV 194
           DEV+R I  +L +V
Sbjct: 181 DEVTREIGRVLDAV 194


>gi|116254567|ref|YP_770403.1| putative adenylate kinase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115259215|emb|CAK10344.1| putative adenylate kinase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 204

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 121/187 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL+++L VPQLSTGDMLRA V + + +G   +  +  G L+ 
Sbjct: 1   MRLIILGPPGAGKGTQAARLAERLGVPQLSTGDMLRAAVTKGSPVGLAARDLIARGELVG 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV   V +RI  P   SGFILDG+PRT+ QA++L   +      +DAV+EL+V+++ +
Sbjct: 61  DDIVVNCVLERIAEPGAASGFILDGFPRTLGQARALDEALEKAHLGLDAVLELKVDESVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A+   VR+DD  +    R+E+YR    PL+ +YR  G L  ++G+  +
Sbjct: 121 LDRIIYRAREAKAAGLPVRADDNPEALKVRLESYRTQTQPLADHYRTAGLLRTVNGLRPV 180

Query: 181 DEVSRSI 187
           DEV+ S+
Sbjct: 181 DEVTSSL 187


>gi|154248694|ref|YP_001419652.1| adenylate kinase [Xanthobacter autotrophicus Py2]
 gi|238686795|sp|A7IPP9|KAD_XANP2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|154162779|gb|ABS69995.1| adenylate kinase [Xanthobacter autotrophicus Py2]
          Length = 195

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 123/191 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA RL  +  + QLSTGDMLRA V   T +G + K  M++G L+S
Sbjct: 1   MRLVLLGPPGAGKGTQAQRLVARHGIVQLSTGDMLRAAVAAGTPVGLKAKAVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+  PD  +GFILDG+PRTV QA++L   +++    +DAVIEL V+   +
Sbjct: 61  DEIVIGIIAERLDSPDAKNGFILDGFPRTVAQAEALDQLLASKGLKLDAVIELVVDQEKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A  ++VR DD   VF  R+E Y +    ++ YY+  G L  IDGM  +
Sbjct: 121 VNRILNRAAEAQAKGEAVRKDDDPVVFKTRLEAYNRDTAVVAPYYKARGQLKQIDGMAPI 180

Query: 181 DEVSRSIDSLL 191
           D+V+ +ID +L
Sbjct: 181 DQVTAAIDGVL 191


>gi|114704505|ref|ZP_01437413.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539290|gb|EAU42410.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Fulvimarina
           pelagi HTCC2506]
          Length = 215

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/213 (43%), Positives = 126/213 (59%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL +K  VPQLSTGDMLRA V   T +GK+ K  M+SG L+S
Sbjct: 1   MRLILLGPPGAGKGTQAKRLVEKHGVPQLSTGDMLRAAVANQTEVGKKAKQIMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVNQ+V DRI  PDC +GFILDGYPRT++QA +L   ++  D  +D V+E++V+D ++
Sbjct: 61  DDIVNQIVSDRIEEPDCANGFILDGYPRTLNQADALDEILTAKDRQLDRVVEMKVDDDAL 120

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                        +  ++E   R DD      +R+  Y K  
Sbjct: 121 VHRITGRYTCSNCGALYHDADKKPAKDGICDKCGSTEFKRREDDNETTVRQRLRAYYKDT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D V+ SI++ +
Sbjct: 181 SPLVGYYHCKGSLARVDGMAEIDAVTTSIENAI 213


>gi|296534008|ref|ZP_06896524.1| adenylate kinase [Roseomonas cervicalis ATCC 49957]
 gi|296265674|gb|EFH11783.1| adenylate kinase [Roseomonas cervicalis ATCC 49957]
          Length = 215

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA RL ++  + Q+STGDMLRAEV   + +G+Q K  ME G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAKRLEERHGIAQISTGDMLRAEVKSGSEIGRQAKAIMEQGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAI+  ++ +R+  PDC  GFILDG+PRT  QA++L   +      +D V+EL+V+DA++
Sbjct: 61  DAIITAMLANRVSQPDCARGFILDGFPRTTPQAEALDVMLREKGLQLDHVVELKVDDAAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTI 158
            +RI  R                     V +A    + V R+DDK +    R+E Y +  
Sbjct: 121 VERIAGRFTCASCGAGYHDSFKPTAVPGVCDACGGTEFVRRADDKAETVAARLEAYHRQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM  MDEV+R I++ L
Sbjct: 181 APLLPYYAAQGKLTQVDGMASMDEVARQIEAAL 213


>gi|92117119|ref|YP_576848.1| adenylate kinase [Nitrobacter hamburgensis X14]
 gi|122418086|sp|Q1QN09|KAD_NITHX RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|91800013|gb|ABE62388.1| Adenylate kinase [Nitrobacter hamburgensis X14]
          Length = 208

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 124/191 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL     + QLSTG+MLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVHHHGIVQLSTGEMLRAAVAAGTPVGLKAKDVMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR+   D  +GFILDG+PRTV QA++L   + + +  +DAV+EL V ++++
Sbjct: 61  DDVVIGIISDRLDQSDAKNGFILDGFPRTVPQAEALDRLLKSKNLKLDAVVELCVNESAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ RV E  A  + VR+DD  +V  KR+ +YR    PL  YY + G L  +DGM+ +
Sbjct: 121 LQRVESRVAEMTARGEQVRADDTPEVLSKRLASYRALTEPLIHYYSERGKLLTVDGMMPI 180

Query: 181 DEVSRSIDSLL 191
           ++V+R I  +L
Sbjct: 181 EQVTRDIYRVL 191


>gi|328543379|ref|YP_004303488.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Polymorphum
           gilvum SL003B-26A1]
 gi|326413124|gb|ADZ70187.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 194

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 120/186 (64%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA RL  + N+PQLSTGDMLRA +   T +G   K  +ESG L+ D 
Sbjct: 1   MILLGPPGAGKGTQAARLVARYNIPQLSTGDMLRAAMAAGTPVGLAAKELVESGKLVPDD 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V  ++ DRI   D ++GFILDG+PRT+ QA +L   ++    A+DAVIELRV+ + +  
Sbjct: 61  VVVGIIRDRIEEKDAENGFILDGFPRTIAQADALGEMLAEKGVALDAVIELRVDQSKLVD 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           RI  R  EA A+ + VR DD  +VF  R++ + +    +  YY   G L +IDGM  +D 
Sbjct: 121 RIMKRAEEAKAAGQPVRKDDDPEVFKDRLDAFNRDTAIVVPYYEKAGLLKVIDGMQSIDA 180

Query: 183 VSRSID 188
           V+++I+
Sbjct: 181 VTQAIE 186


>gi|209552151|ref|YP_002284067.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209539744|gb|ACI59675.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 192

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 122/187 (65%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS   NVPQLSTGDMLRA V   + +G   K  ++SG L+ 
Sbjct: 1   MRLVMLGPPGAGKGTQARKLSAHFNVPQLSTGDMLRAAVSSGSPVGLAAKSVIDSGGLVG 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV   V +R+   D   GFILDG+PRTV QAKSL + +     ++  VIEL V++  +
Sbjct: 61  DKIVIDCVQERLSHDDARRGFILDGFPRTVAQAKSLDSMLGPGKRSLSTVIELLVDEELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ R  EAIA+ ++ RSDD  +   KR+  YR++   LS++Y + G L  IDGM D+
Sbjct: 121 AQRIERRAGEAIANGETPRSDDNIETMRKRLAAYRESTEVLSNFYYNQGRLVRIDGMRDV 180

Query: 181 DEVSRSI 187
           D+V+  I
Sbjct: 181 DQVTADI 187


>gi|170739116|ref|YP_001767771.1| adenylate kinase [Methylobacterium sp. 4-46]
 gi|168193390|gb|ACA15337.1| adenylate kinase [Methylobacterium sp. 4-46]
          Length = 205

 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 117/193 (60%), Gaps = 4/193 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQ+  LS    +PQLSTGDMLRA V   T +G+  K  ME G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQSQLLSTHFGIPQLSTGDMLRAAVAAQTPIGRAAKAVMEEGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +R+ + D  +GFILDG+PRT+ QA +L   +      ++AV+EL V+   +
Sbjct: 61  DEIVTGIVSERLGMADATAGFILDGFPRTIAQAGALDGVLLAKGVMLNAVVELVVDPEIL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  RV E +A  + VR DD  + F +R+  Y     PL+ YY +   L  IDGM  +
Sbjct: 121 VLRMTARVTETLARGEPVRRDDNPEAFSRRLVAYSTETAPLTRYYAERSLLQPIDGMRPV 180

Query: 181 DEV----SRSIDS 189
           DEV    +R++D+
Sbjct: 181 DEVFDEITRALDA 193


>gi|86357326|ref|YP_469218.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Rhizobium
           etli CFN 42]
 gi|123512264|sp|Q2K9J5|KAD_RHIEC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|86281428|gb|ABC90491.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Rhizobium
           etli CFN 42]
          Length = 216

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 125/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V+  T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVNAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +      +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLKAKGLDLSVVIEFRVDDEEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + +  E+ V           R DD  +  +KR+E Y K  
Sbjct: 121 VRRVDGRYTCAQCGTVYHDTDKVPVEEGVCDKCGSTHFKRRPDDNAETMIKRLEVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++++L
Sbjct: 181 SPLIGYYHAKGKLRPVDGMAEIDQVTAEVEAIL 213


>gi|254470377|ref|ZP_05083781.1| adenylate kinase [Pseudovibrio sp. JE062]
 gi|211960688|gb|EEA95884.1| adenylate kinase [Pseudovibrio sp. JE062]
          Length = 190

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 120/194 (61%), Gaps = 4/194 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +G +VK  +  G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGRLVAAHGIVQLSTGDMLRAAVAAETEVGLKVKDVLTRGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DRI   DC  GFILDG+PRT+ QA +L   +   +  +DAV++L+V++  +
Sbjct: 61  DDLICSIISDRIDQADCAKGFILDGFPRTIAQADALGELLEKKNQRLDAVVQLKVDEGIL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ R  E+      VRSDD  +   KR+  Y +   PL  YY +   L  +DGM  +
Sbjct: 121 LERIETRARES----AEVRSDDNAESLKKRLAVYNEQTAPLIQYYGERNMLMTVDGMKSV 176

Query: 181 DEVSRSIDSLLVSV 194
           DEV+  ID++L +V
Sbjct: 177 DEVAAEIDTILSTV 190


>gi|304391476|ref|ZP_07373418.1| adenylate kinase [Ahrensia sp. R2A130]
 gi|303295705|gb|EFL90063.1| adenylate kinase [Ahrensia sp. R2A130]
          Length = 216

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 124/216 (57%), Gaps = 22/216 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL ++  +PQLSTGDMLRA V   T  G + K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAHRLVEEHKIPQLSTGDMLRAAVAAGTETGLRAKAIMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V DRI   DC +GFILDGYPRT+ QA ++ A ++    A+DAV+ELRV+D +M
Sbjct: 61  DDVVNAIVSDRIDEADCANGFILDGYPRTLPQADAVEAMLAEKGTALDAVVELRVDDDAM 120

Query: 121 FKRIQVRVL-----------------EAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
            +R+  R                   E +     + E   R DD  +    R++ Y K  
Sbjct: 121 VERVAGRYTCANCGAGYHDTLNKPEAEGVCDKCGSKEFKRRPDDNAEAMRTRLQVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
            PL  YY     L  +DGM  +D+VS  I ++L  V
Sbjct: 181 SPLIGYYYAKEKLRTVDGMGAIDQVSEEIGAVLAQV 216


>gi|58038834|ref|YP_190798.1| adenylate kinase [Gluconobacter oxydans 621H]
 gi|58001248|gb|AAW60142.1| Adenylate kinase [Gluconobacter oxydans 621H]
          Length = 193

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 118/196 (60%), Gaps = 4/196 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL     + Q+STGDMLRAEV   + +G + K  ME G  + 
Sbjct: 1   MNIILLGPPGAGKGTQAKRLEALYGLKQISTGDMLRAEVAAGSAIGNEAKAIMEKGQFVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI  PDC+ GFILDG+PRT  QA++L   +S     IDAVI L V +  +
Sbjct: 61  DPIIVAMIQNRIAQPDCERGFILDGFPRTESQAEALDTMLSARGLTIDAVILLDVNEEKL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  E    + + R DD  DV   R++ YRK   P+  YY   G L  +DGM D+
Sbjct: 121 VERIASRCGE----DGTRRPDDNPDVVRARLDVYRKQTAPILPYYERAGRLLHVDGMKDV 176

Query: 181 DEVSRSIDSLLVSVRK 196
           + V + ID+++ + +K
Sbjct: 177 ESVGKEIDAIVAAAKK 192


>gi|327189692|gb|EGE56839.1| adenylate kinase protein [Rhizobium etli CNPAF512]
          Length = 216

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVGAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +      +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLKAKGLDLSVVIEFRVDDQEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + +  E+ V           R DD  +  +KR+E Y K  
Sbjct: 121 VRRVDGRYTCAQCGTVYHDTDKVPVEEGVCDKCGSTHFKRRPDDNAETMIKRLEVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++S+L
Sbjct: 181 SPLIGYYYAKGKLRSVDGMAEIDQVTTEVESIL 213


>gi|317125851|ref|YP_004099963.1| adenylate kinase [Intrasporangium calvum DSM 43043]
 gi|315589939|gb|ADU49236.1| Adenylate kinase [Intrasporangium calvum DSM 43043]
          Length = 192

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 118/187 (63%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  ++++L +P +STGD+ R  +   T LG++V+  + SG  + 
Sbjct: 1   MRMIILGPPGAGKGTQAAHIAERLQIPAISTGDIFRTNIKEQTELGRKVEAILASGGYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+  PD   GF+LDGYPRT  Q ++L   +S    A+DAV+EL V++ ++
Sbjct: 61  DEVTNEIVEDRLSWPDATEGFLLDGYPRTAGQVEALEGMLSRRGHALDAVLELTVDEDAV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +V  +R   YR+   PL+ +Y D G L  +DGM ++
Sbjct: 121 VERLLKR------AEIEGRADDSEEVIRERQAIYRRETAPLAEHYADAGLLVQVDGMGEV 174

Query: 181 DEVSRSI 187
           DEV+  I
Sbjct: 175 DEVTDRI 181


>gi|163796898|ref|ZP_02190855.1| Adenylate kinase, subfamily protein [alpha proteobacterium BAL199]
 gi|159177887|gb|EDP62436.1| Adenylate kinase, subfamily protein [alpha proteobacterium BAL199]
          Length = 188

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 116/184 (63%), Gaps = 6/184 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA RL +   + QLSTGDMLR  V   + LG++ K  M++G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAKRLEETYGIKQLSTGDMLREAVASGSDLGREAKRIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+++ +++ +R+  PDC +GFILDG+PRTV QA++L   +   D AID VIE +V++ +M
Sbjct: 61  DSVMVRMISERVDQPDCRNGFILDGFPRTVAQAEALDQMLDEKDLAIDHVIEFQVDEDAM 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E        RSDD  +   KR++ YR+   P+  +YR  G L  IDGM  M
Sbjct: 121 VARILKRAAE------EGRSDDNEETLRKRLDVYRRQTAPIVPHYRAKGALKTIDGMASM 174

Query: 181 DEVS 184
           D V+
Sbjct: 175 DVVT 178


>gi|218674114|ref|ZP_03523783.1| adenylate kinase (ATP-AMP transphosphorylase) protein [Rhizobium
           etli GR56]
          Length = 216

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 124/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V+  T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVNAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC  GFILDG+PRT+ QA +  A +      +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCADGFILDGFPRTLVQADATEAMLKAKGLDLSVVIEFRVDDQEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + +  E+ V           R DD  +  +KR+E Y K  
Sbjct: 121 VRRVDGRYTCAQCGTVYHDTDKVPVEEGVCDKCGSTHFKRRPDDNAETMIKRLEVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++++L
Sbjct: 181 SPLIGYYYAKGKLKSVDGMAEIDQVTAEVETIL 213


>gi|222085696|ref|YP_002544226.1| adenylate kinase (ATP-AMP transphosphorylase) protein
           [Agrobacterium radiobacter K84]
 gi|254806964|sp|B9JDU9|KAD_AGRRK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|221723144|gb|ACM26300.1| adenylate kinase (ATP-AMP transphosphorylase) protein
           [Agrobacterium radiobacter K84]
          Length = 216

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 127/213 (59%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVAAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V +RI  PDC  GFILDG+PRT+ QA +  A +      + AVIE++V+DA +
Sbjct: 61  DDIVNAIVSERIDQPDCARGFILDGFPRTLVQADATEAMLKAKGLELSAVIEIKVDDAVL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                  +E +     ++    R+DD  +  ++R++ Y K  
Sbjct: 121 ADRISGRYTCANCGAGYHDENLRPKVEGVCDRCGSTHFKRRADDNRETVVERLQVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM D++ V+ +I+++L
Sbjct: 181 SPLIGYYYAKGKLQSVDGMADIEHVTANIEAIL 213


>gi|190891376|ref|YP_001977918.1| adenylate kinase protein [Rhizobium etli CIAT 652]
 gi|226743895|sp|B3PWU2|KAD_RHIE6 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|190696655|gb|ACE90740.1| adenylate kinase protein [Rhizobium etli CIAT 652]
          Length = 216

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVGVGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +      +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLKAKGLDLSVVIEFRVDDQEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + +  E+ V           R DD  +  +KR+E Y K  
Sbjct: 121 VRRVDGRYTCAQCGTVYHDTDKVPVEEGVCDKCGSTHFKRRPDDNAETMIKRLEVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++S+L
Sbjct: 181 SPLIGYYYAKGKLRSVDGMAEIDQVTTEVESIL 213


>gi|183221327|ref|YP_001839323.1| adenylate kinase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
 gi|189911419|ref|YP_001962974.1| adenylate kinase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|238687773|sp|B0SA26|KAD_LEPBA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238687825|sp|B0SSF7|KAD_LEPBP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|167776095|gb|ABZ94396.1| Adenylate kinase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167779749|gb|ABZ98047.1| Adenylate kinase (ATP-AMP transphosphorylase) [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 186

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 117/186 (62%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IF+GPPG+GKGTQA  + +K N+PQ+STGD+LRA V   T +G + K  M++G L+ D
Sbjct: 3   RLIFMGPPGAGKGTQADIIKEKYNIPQISTGDILRAAVKNGTAMGIEAKKYMDAGDLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  ++ DR+   DC +GFILDG+PRTV+QAK+L   +  +   +D+V+ L V D  + 
Sbjct: 63  AVVIGIIRDRLVEADCANGFILDGFPRTVEQAKALSEILKELHMELDSVVNLDVPDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+  R +      K  RSDD  +    R+  Y    LPL  +Y+  G L  I+G+  M+
Sbjct: 123 KRLLGRAI------KEGRSDDNEETIKNRLHTYNTKTLPLIDFYKATGILRQINGLGSME 176

Query: 182 EVSRSI 187
           E++ +I
Sbjct: 177 EITNTI 182


>gi|15607873|ref|NP_215247.1| adenylate kinase [Mycobacterium tuberculosis H37Rv]
 gi|15840140|ref|NP_335177.1| adenylate kinase [Mycobacterium tuberculosis CDC1551]
 gi|31791919|ref|NP_854412.1| adenylate kinase [Mycobacterium bovis AF2122/97]
 gi|121636655|ref|YP_976878.1| adenylate kinase [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148660508|ref|YP_001282031.1| adenylate kinase [Mycobacterium tuberculosis H37Ra]
 gi|148821938|ref|YP_001286692.1| adenylate kinase [Mycobacterium tuberculosis F11]
 gi|167968292|ref|ZP_02550569.1| adenylate kinase [Mycobacterium tuberculosis H37Ra]
 gi|215402517|ref|ZP_03414698.1| adenylate kinase [Mycobacterium tuberculosis 02_1987]
 gi|215410291|ref|ZP_03419099.1| adenylate kinase [Mycobacterium tuberculosis 94_M4241A]
 gi|215425978|ref|ZP_03423897.1| adenylate kinase [Mycobacterium tuberculosis T92]
 gi|215429574|ref|ZP_03427493.1| adenylate kinase [Mycobacterium tuberculosis EAS054]
 gi|215444859|ref|ZP_03431611.1| adenylate kinase [Mycobacterium tuberculosis T85]
 gi|218752384|ref|ZP_03531180.1| adenylate kinase [Mycobacterium tuberculosis GM 1503]
 gi|224989127|ref|YP_002643814.1| adenylate kinase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797677|ref|YP_003030678.1| adenylate kinase adk [Mycobacterium tuberculosis KZN 1435]
 gi|254231050|ref|ZP_04924377.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis C]
 gi|254363679|ref|ZP_04979725.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis str. Haarlem]
 gi|254549695|ref|ZP_05140142.1| adenylate kinase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260185616|ref|ZP_05763090.1| adenylate kinase [Mycobacterium tuberculosis CPHL_A]
 gi|260199744|ref|ZP_05767235.1| adenylate kinase [Mycobacterium tuberculosis T46]
 gi|260203905|ref|ZP_05771396.1| adenylate kinase [Mycobacterium tuberculosis K85]
 gi|289442134|ref|ZP_06431878.1| adenylate kinase adk [Mycobacterium tuberculosis T46]
 gi|289446293|ref|ZP_06436037.1| adenylate kinase adk [Mycobacterium tuberculosis CPHL_A]
 gi|289552990|ref|ZP_06442200.1| adenylate kinase adk [Mycobacterium tuberculosis KZN 605]
 gi|289573341|ref|ZP_06453568.1| adenylate kinase adk [Mycobacterium tuberculosis K85]
 gi|289744457|ref|ZP_06503835.1| adenylate kinase adk [Mycobacterium tuberculosis 02_1987]
 gi|289749241|ref|ZP_06508619.1| adenylate kinase adk [Mycobacterium tuberculosis T92]
 gi|289752780|ref|ZP_06512158.1| adenylate kinase [Mycobacterium tuberculosis EAS054]
 gi|289756821|ref|ZP_06516199.1| adenylate kinase [Mycobacterium tuberculosis T85]
 gi|289760860|ref|ZP_06520238.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis GM 1503]
 gi|294996216|ref|ZP_06801907.1| adenylate kinase [Mycobacterium tuberculosis 210]
 gi|297633233|ref|ZP_06951013.1| adenylate kinase [Mycobacterium tuberculosis KZN 4207]
 gi|297730213|ref|ZP_06959331.1| adenylate kinase [Mycobacterium tuberculosis KZN R506]
 gi|298524224|ref|ZP_07011633.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis 94_M4241A]
 gi|306787756|ref|ZP_07426078.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu004]
 gi|306794524|ref|ZP_07432826.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu005]
 gi|306796489|ref|ZP_07434791.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu006]
 gi|306970947|ref|ZP_07483608.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu010]
 gi|313657540|ref|ZP_07814420.1| adenylate kinase [Mycobacterium tuberculosis KZN V2475]
 gi|60392509|sp|P69439|KAD_MYCBO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|60392510|sp|P69440|KAD_MYCTU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980332|sp|A1KGL4|KAD_MYCBP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980336|sp|A5U0B9|KAD_MYCTA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806997|sp|C1AL67|KAD_MYCBT RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|42543246|pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate
           Kinase
 gi|2911007|emb|CAA17500.1| PROBABLE ADENYLATE KINASE ADK (ATP-AMP TRANSPHOSPHORYLASE)
           [Mycobacterium tuberculosis H37Rv]
 gi|4191722|gb|AAD09879.1| adenylate kinase [Mycobacterium bovis]
 gi|13880292|gb|AAK44991.1| adenylate kinase [Mycobacterium tuberculosis CDC1551]
 gi|31617506|emb|CAD93616.1| PROBABLE ADENYLATE KINASE ADK (ATP-AMP TRANSPHOSPHORYLASE)
           [Mycobacterium bovis AF2122/97]
 gi|121492302|emb|CAL70769.1| Probable adenylate kinase adk [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|124600109|gb|EAY59119.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis C]
 gi|134149193|gb|EBA41238.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis str. Haarlem]
 gi|148504660|gb|ABQ72469.1| adenylate kinase [Mycobacterium tuberculosis H37Ra]
 gi|148720465|gb|ABR05090.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis F11]
 gi|224772240|dbj|BAH25046.1| adenylate kinase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319180|gb|ACT23783.1| adenylate kinase adk [Mycobacterium tuberculosis KZN 1435]
 gi|289415053|gb|EFD12293.1| adenylate kinase adk [Mycobacterium tuberculosis T46]
 gi|289419251|gb|EFD16452.1| adenylate kinase adk [Mycobacterium tuberculosis CPHL_A]
 gi|289437622|gb|EFD20115.1| adenylate kinase adk [Mycobacterium tuberculosis KZN 605]
 gi|289537772|gb|EFD42350.1| adenylate kinase adk [Mycobacterium tuberculosis K85]
 gi|289684985|gb|EFD52473.1| adenylate kinase adk [Mycobacterium tuberculosis 02_1987]
 gi|289689828|gb|EFD57257.1| adenylate kinase adk [Mycobacterium tuberculosis T92]
 gi|289693367|gb|EFD60796.1| adenylate kinase [Mycobacterium tuberculosis EAS054]
 gi|289708366|gb|EFD72382.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis GM 1503]
 gi|289712385|gb|EFD76397.1| adenylate kinase [Mycobacterium tuberculosis T85]
 gi|298494018|gb|EFI29312.1| adenylate kinase adk (ATP-AMP transphosphorylase) [Mycobacterium
           tuberculosis 94_M4241A]
 gi|308335665|gb|EFP24516.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu004]
 gi|308337122|gb|EFP25973.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu005]
 gi|308343147|gb|EFP31998.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu006]
 gi|308359567|gb|EFP48418.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu010]
 gi|323720860|gb|EGB29927.1| adenylate kinase adk [Mycobacterium tuberculosis CDC1551A]
 gi|326905045|gb|EGE51978.1| adenylate kinase adk [Mycobacterium tuberculosis W-148]
 gi|328457457|gb|AEB02880.1| adenylate kinase adk [Mycobacterium tuberculosis KZN 4207]
          Length = 181

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 122/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +L++KL +PQ+STG++ R  ++  T LG + K  +++G L+ 
Sbjct: 1   MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V DR+  PD  +GFILDGYPR+V+QAK+LH  +      IDAV+E RV +  +
Sbjct: 61  SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV L R++ YR    PL  YYRD   L  +D +  M
Sbjct: 121 LERLKGR----------GRADDTDDVILNRMKVYRDETAPLLEYYRDQ--LKTVDAVGTM 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALRAL 179


>gi|109157291|pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate
           Kinase Complexed With Two Molecules Of Adp And Mg
          Length = 201

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 122/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +L++KL +PQ+STG++ R  ++  T LG + K  +++G L+ 
Sbjct: 21  MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVP 80

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V DR+  PD  +GFILDGYPR+V+QAK+LH  +      IDAV+E RV +  +
Sbjct: 81  SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVL 140

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV L R++ YR    PL  YYRD   L  +D +  M
Sbjct: 141 LERLKGR----------GRADDTDDVILNRMKVYRDETAPLLEYYRDQ--LKTVDAVGTM 188

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 189 DEVFARALRAL 199


>gi|320094559|ref|ZP_08026325.1| adenylate kinase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319978474|gb|EFW10051.1| adenylate kinase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 192

 Score =  161 bits (407), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 125/195 (64%), Gaps = 6/195 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA R++Q+L++P +STGD+ RA +   T +GKQ K  M+ G  + D+
Sbjct: 4   VILLGPPGAGKGTQAARIAQRLSIPAISTGDIFRANMAEGTEIGKQAKAYMDRGEFVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V  R+  PD   GF+LDGYPR+V+QA +L   + ++   ID V+E++V++  +  
Sbjct: 64  VTNTMVRARLAAPDTADGFLLDGYPRSVEQAHTLRDMLLDLGKQIDVVVEIQVDEDEVVA 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +++  RSDD   V  +R+E YR+   P+++YY D   L  +DG   +DE
Sbjct: 124 RMLKR------AQEQHRSDDTEPVMRRRLEVYRQQTEPVATYYVDQDLLEAVDGKGTIDE 177

Query: 183 VSRSIDSLLVSVRKK 197
           V+  I+++L SV ++
Sbjct: 178 VTARINTVLDSVARR 192


>gi|327400978|ref|YP_004341817.1| adenylate kinase [Archaeoglobus veneficus SNP6]
 gi|327316486|gb|AEA47102.1| Adenylate kinase [Archaeoglobus veneficus SNP6]
          Length = 217

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 88/216 (40%), Positives = 123/216 (56%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPGSGKGTQA  + +K  +PQ+STGDMLR  V + T LGK+ K  M+ G L+ 
Sbjct: 1   MNLILLGPPGSGKGTQAKLIVEKYGIPQISTGDMLREAVAKGTELGKKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R++ PDCD GFILDG+PRT+ QA++L   +  +   IDAVI ++V +  +
Sbjct: 61  DEVVIGIVKERLKQPDCDKGFILDGFPRTIAQAEALDKMLEELGKKIDAVINIQVPEEEV 120

Query: 121 FKRIQVR--------VLEAI-------------ASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R        V   I               E   R DDK D    R + YR+   
Sbjct: 121 VKRIVNRRSCRNCGAVYHLIYKPPKEEGKCDKCGGELYQRDDDKEDTVRARYQVYREQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY+  G LY IDG   +D+V + I+++L  ++
Sbjct: 181 PLIDYYQKKGLLYNIDGTKSIDDVFKDIEAILEKIK 216


>gi|11498284|ref|NP_069510.1| adenylate kinase [Archaeoglobus fulgidus DSM 4304]
 gi|9910707|sp|O29581|KAD_ARCFU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|2649941|gb|AAB90565.1| adenylate kinase (adk) [Archaeoglobus fulgidus DSM 4304]
          Length = 217

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 126/216 (58%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLGPPG+GKGTQA R+S+K  +PQ+STGDMLR  V + T LGK+ K  M+ G L+ 
Sbjct: 1   MNLIFLGPPGAGKGTQAKRVSEKYGIPQISTGDMLREAVAKGTELGKKAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R++ PDC+ GFILDG+PRT+ QA++L   +  ++  IDAVI + V +  +
Sbjct: 61  DEVVIGIVKERLQQPDCEKGFILDGFPRTLAQAEALDEMLKELNKKIDAVINVVVPEEEV 120

Query: 121 FKRIQVR--------VLEAI-------------ASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R        V   I               E   R DDK +   +R   Y++   
Sbjct: 121 VKRITYRRTCRNCGAVYHLIYAPPKEDNKCDKCGGELYQRDDDKEETVRERYRVYKQNTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YYR  G LY +DG  D++ V + I+++L  ++
Sbjct: 181 PLIDYYRKKGILYDVDGTKDIEGVWKEIEAILEKIK 216


>gi|259415828|ref|ZP_05739748.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter sp.
           TrichCH4B]
 gi|259347267|gb|EEW59044.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter sp.
           TrichCH4B]
          Length = 193

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 116/189 (61%), Gaps = 1/189 (0%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II LGPPG+GKGTQA  L +  N+ QLSTGDMLRA     + +GK+V   M  G L++D 
Sbjct: 4   IILLGPPGAGKGTQASHLVESRNMTQLSTGDMLRAAQSSGSEMGKKVAAIMAEGKLVTDQ 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ +R++    + GFI DG+PRT+ QA +L   ++ MD  +DAVIE++V+D  + K
Sbjct: 64  IVIGLIRERLQ-EGSEGGFIFDGFPRTLAQADALEKLLAEMDLKLDAVIEMQVDDEVLVK 122

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           RI  R  EA A+ K  R+DD  +    R+  Y K   PL  YY   G L  +DGM  +DE
Sbjct: 123 RIVNRAEEARAAGKEARADDNEESVRIRLMEYYKKTSPLIGYYWAKGNLQRLDGMASIDE 182

Query: 183 VSRSIDSLL 191
           V +SI  +L
Sbjct: 183 VQKSIAWIL 191


>gi|241204186|ref|YP_002975282.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858076|gb|ACS55743.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 216

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 124/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA  +  T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAATEAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +    + +    +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEGMLKSKGLDLSVVIEFRVDDKEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + + +++ V           R DD  +  +KR+E Y K  
Sbjct: 121 IRRVDGRYTCVQCGTVYHDTDKLPAKEGVCDKCGSTHFKRRPDDNAETMIKRLEVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY     L  +DGM ++D+V+  ++S+L
Sbjct: 181 SPLIGYYHAKDKLKSVDGMAEIDQVTAEVESIL 213


>gi|296168597|ref|ZP_06850401.1| adenylate kinase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295896660|gb|EFG76299.1| adenylate kinase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 181

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 120/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+KL +P +STG++ R+ ++  T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLSEKLGIPHISTGELFRSNIENGTKLGLEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+   D  +GFILDG+PR+ +QAK+LHA +      IDAV+E RV    +
Sbjct: 61  SELTNQLVDDRLSDADAANGFILDGFPRSTEQAKALHAMLERRGTDIDAVLEFRVSQEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV L R++ YR    PL  YYRD   L  +D +  M
Sbjct: 121 LQRLKSR----------GRADDTDDVILNRMKVYRDETAPLLEYYRD--ELKTVDAIGTM 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|315605920|ref|ZP_07880951.1| adenylate kinase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315312202|gb|EFU60288.1| adenylate kinase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 192

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 125/195 (64%), Gaps = 6/195 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA R++++L++P +STGD+ RA +   T +GKQ +  M+ G  + D+
Sbjct: 4   VILLGPPGAGKGTQASRIAERLDIPAISTGDIFRANMAEGTEIGKQAQAYMDRGEFVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V  R+  PD  +GF+LDGYPR+V+QA  L   + ++  +ID V+E++V++  + +
Sbjct: 64  VTNTMVKARLAAPDTANGFLLDGYPRSVEQAHVLRDMLLDLGTSIDVVLEIQVDEDEVVE 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +++  R+DD   V   R+E Y +  LP+++YY D   L ++DG   +DE
Sbjct: 124 RMLKR------AQEQHRTDDTEPVMRHRLEVYHQQTLPVATYYVDQDLLEVVDGTGSIDE 177

Query: 183 VSRSIDSLLVSVRKK 197
           V+  I ++L SV  K
Sbjct: 178 VTARIFAILDSVASK 192


>gi|288931478|ref|YP_003435538.1| adenylate kinase [Ferroglobus placidus DSM 10642]
 gi|288893726|gb|ADC65263.1| adenylate kinase [Ferroglobus placidus DSM 10642]
          Length = 218

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 121/217 (55%), Gaps = 21/217 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA  + +K  +PQ+STGD+LR  V + T LG++ K  M+ G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAKMIVEKYGIPQISTGDILREAVAKGTELGRKAKEYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+  PDC+ GFILDG+PRTV QA++L   +  M   IDAVI + V +  +
Sbjct: 61  DEVVIGIVRERLSQPDCEKGFILDGFPRTVRQAEALDEMLDEMGRKIDAVISIEVPEEEI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R +                     +    E   R DDK +V  +R   Y++   
Sbjct: 121 VKRIVYRRICKQCGAVYNLIYNPPKVDGKCDKCGGELYQRDDDKEEVVRERYRVYKEQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  YYR  G LY +DG   ++EV   IDS+L  + K
Sbjct: 181 PLKEYYRRTGVLYEVDGTKSIEEVFNEIDSILQKISK 217


>gi|254822306|ref|ZP_05227307.1| adenylate kinase [Mycobacterium intracellulare ATCC 13950]
          Length = 181

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 121/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+KL +PQ+STG++ R+ ++  T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+  PD  +GFILDG+PR++ QAK+LH  +      IDAV+E RV    +
Sbjct: 61  SELTNQLVDDRLSDPDAANGFILDGFPRSLQQAKALHEMLERRGTDIDAVLEFRVSQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV L R++ YR    PL  YYRD   L  +D +  +
Sbjct: 121 LQRLKSR----------GRADDTDDVILNRMKVYRDETAPLLDYYRD--ELKTVDAIGTL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|293190238|ref|ZP_06608734.1| adenylate kinase [Actinomyces odontolyticus F0309]
 gi|292821054|gb|EFF80007.1| adenylate kinase [Actinomyces odontolyticus F0309]
          Length = 192

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 123/195 (63%), Gaps = 6/195 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA R++++L +P +STGD+ RA +   T +GKQ +  M+ G  + D+
Sbjct: 4   VILLGPPGAGKGTQASRIAERLGIPAISTGDIFRANMAEGTEIGKQAQAYMDRGEFVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V  R+  PD   GF+LDGYPRTV+QA  L   + ++  +ID V+E++V++  + +
Sbjct: 64  VTNAMVKARLAAPDAADGFLLDGYPRTVEQAHVLRDMLLDLGKSIDVVLEIQVDEDEVVE 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +++  R+DD   V   R+E Y +  LP+++YY D   L ++DG   +DE
Sbjct: 124 RMLKR------AQEQHRTDDTEPVIRHRLEVYHQQTLPVATYYVDQDLLEVVDGSGTIDE 177

Query: 183 VSRSIDSLLVSVRKK 197
           V+  I ++L SV K 
Sbjct: 178 VTARIFAILDSVAKN 192


>gi|218458309|ref|ZP_03498400.1| adenylate kinase [Rhizobium etli Kim 5]
          Length = 206

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 119/206 (57%), Gaps = 22/206 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVGAGTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +     A+  V+E RV+DA +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLKAKGLALSVVVEFRVDDAEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + + + + V           R DD  +    R++ Y K  
Sbjct: 121 VRRVAGRYSCAQCGSVYHDTDKVPANEGVCDKCGSTHFKRRPDDTPETMTARLQVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS 184
            PL  YY   G L  +DGM ++D+V+
Sbjct: 181 SPLIGYYHAKGKLRSVDGMAEIDQVT 206


>gi|116251561|ref|YP_767399.1| adenylate kinase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256209|emb|CAK07290.1| putative adenylate kinase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 216

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V+  T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVNAGTDVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +      +  VIE RV D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLKAKGLDLSVVIEFRVNDDEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + + + + V           R DD  +    R++ Y K  
Sbjct: 121 VRRVAGRYSCAQCGSVYHDTDKVPAAEGVCDKCGSTHFKRRPDDTPETMTARLQVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++S+L
Sbjct: 181 SPLIGYYHAKGKLKSVDGMAEIDQVTAEVESIL 213


>gi|209548956|ref|YP_002280873.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534712|gb|ACI54647.1| adenylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 216

 Score =  158 bits (399), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 123/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ +K  +PQLSTGDMLRA V+  T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVEKHGIPQLSTGDMLRAAVNAGTDVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC +GFILDG+PRT+ QA +  A +      +  VIE RV+D  +
Sbjct: 61  DEIVIAIVSERIDQPDCANGFILDGFPRTLVQADATEAMLRAKGLGLSVVIEFRVDDDEL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R             + + + + V           R DD  +    R++ Y K  
Sbjct: 121 VRRVAGRYSCAQCGSVYHDTDKVPAAEGVCDKCGSTHFKRRPDDNPETMTARLQVYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM ++D+V+  ++++L
Sbjct: 181 SPLIGYYHAKGKLRSVDGMAEIDQVTAEVENIL 213


>gi|99080117|ref|YP_612271.1| adenylate kinase [Ruegeria sp. TM1040]
 gi|99036397|gb|ABF63009.1| Adenylate kinase [Ruegeria sp. TM1040]
          Length = 193

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 115/189 (60%), Gaps = 1/189 (0%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II LGPPG+GKGTQA  L +  N+ QLSTGDMLRA     + +GK+V   M  G L++D 
Sbjct: 4   IILLGPPGAGKGTQASHLVKTRNMTQLSTGDMLRAAQSSGSEMGKKVAAIMAEGKLVTDQ 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ +R++    + GFI DG+PRT+ QA +L   ++ M   +DAVIE++V+D  + K
Sbjct: 64  IVIGLIRERLQ-EGSEGGFIFDGFPRTLAQADALEKLLTEMGLKLDAVIEMQVDDEVLVK 122

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           RI  R  EA A+ K  R+DD  D    R+  Y K   PL  YY   G L  +DGM  +DE
Sbjct: 123 RIVNRAEEARAAGKEARADDNEDSVRIRLMEYYKKTSPLIGYYWAKGNLQRLDGMASIDE 182

Query: 183 VSRSIDSLL 191
           V +SI  +L
Sbjct: 183 VQKSIAWIL 191


>gi|229220808|ref|YP_883568.2| adenylate kinase [Mycobacterium avium 104]
 gi|254776869|ref|ZP_05218385.1| adenylate kinase [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 181

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 120/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+KL +PQ+STG++ R+ ++  T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+  PD  +GFILDG+PR++ QAK+LH  +      IDAV+E RV    +
Sbjct: 61  AELTNQLVDDRLSEPDAANGFILDGFPRSLQQAKALHEMLERRGTDIDAVLEFRVSQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R+DD  +V L R++ YR    PL  YYRD   L  +D +  +
Sbjct: 121 LARLKAR----------GRADDTDEVILNRMKVYRDETAPLLDYYRDQ--LKTVDAVGTL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALRAL 179


>gi|154507843|ref|ZP_02043485.1| hypothetical protein ACTODO_00325 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797477|gb|EDN79897.1| hypothetical protein ACTODO_00325 [Actinomyces odontolyticus ATCC
           17982]
          Length = 192

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 122/195 (62%), Gaps = 6/195 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA R++++L +P +STGD+ RA +   T +GKQ +  M+ G  + D+
Sbjct: 4   VILLGPPGAGKGTQASRIAERLGIPAISTGDIFRANMAEGTEIGKQAQAYMDRGEFVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V  R+  PD   GF+LDGYPRTV+QA  L   + ++  +ID V+E++V++  +  
Sbjct: 64  VTNAMVKARLAAPDAADGFLLDGYPRTVEQAHVLRDMLLDLGKSIDVVLEIQVDEDEVVA 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +++  R+DD   V   R+E Y +  LP+++YY D   L ++DG   +DE
Sbjct: 124 RMLKR------AQEQHRTDDTEPVIRHRLEVYHQQTLPVATYYVDQDLLEVVDGSGTIDE 177

Query: 183 VSRSIDSLLVSVRKK 197
           V+  I ++L SV K 
Sbjct: 178 VTARIFAILDSVAKN 192


>gi|117925050|ref|YP_865667.1| adenylate kinase [Magnetococcus sp. MC-1]
 gi|166219989|sp|A0L8G8|KAD_MAGSM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|117608806|gb|ABK44261.1| Adenylate kinase [Magnetococcus sp. MC-1]
          Length = 213

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 123/212 (58%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +GPPG+GKGTQA ++S+K  +PQLSTGDMLRA V   + +G + K +MESGSL++
Sbjct: 1   MKVVLMGPPGAGKGTQARKISEKYGIPQLSTGDMLRAAVAAGSEVGLRAKAAMESGSLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DR    DCD G++LDG+PRT+ QA+ L A ++  + +ID VI+++VED  +
Sbjct: 61  DEIVLGIIQDRTDEADCDQGYLLDGFPRTLAQAEGLDAMLAKRNQSIDVVIDIKVEDEPL 120

Query: 121 FKRI---------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI                     Q  V +  +     R+DD  D    R+E Y K   
Sbjct: 121 VARITGRSSCEKCGEGYHDSFKPSAQPNVCDKCSGTLKRRADDNADTVRNRLEVYHKQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DGM +M +V   + ++L
Sbjct: 181 PLIGYYDAKGLLKEVDGMQEMGKVLEDLCAIL 212


>gi|114327239|ref|YP_744396.1| adenylate kinase [Granulibacter bethesdensis CGDNIH1]
 gi|114315413|gb|ABI61473.1| adenylate kinase [Granulibacter bethesdensis CGDNIH1]
          Length = 226

 Score =  157 bits (396), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 125/213 (58%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + +I LGPPG+GKGTQA RL  K  + Q+STGDMLRAEV   + +G++ K  MESG+L+ 
Sbjct: 5   LNLILLGPPGAGKGTQAKRLQDKHGIAQISTGDMLRAEVAAGSEIGQRAKAIMESGALMP 64

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RI   DC +GFILDG+PRTV QA++L   ++     + AVIEL V+DA++
Sbjct: 65  DDVIIDMLAGRIGQSDCANGFILDGFPRTVPQAEALDEMLTRKALELSAVIELAVDDAAL 124

Query: 121 FKRIQVR---------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTI 158
             RI  R                     V +   S + V R+DD  +  + R+E Y +  
Sbjct: 125 VDRIAGRFTCSKCGTGYHDTFKPTAEAGVCDQCGSTEFVRRADDNRETVVARLEAYHRQT 184

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+  YY+  G L  +DGM DMD V++ I+S+L
Sbjct: 185 APILPYYKAQGRLRSVDGMADMDTVTKDIESIL 217


>gi|41410297|ref|NP_963133.1| adenylate kinase [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|68568783|sp|Q73S77|KAD_MYCPA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|41399131|gb|AAS06749.1| Adk [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 181

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 12/183 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+KL +PQ+STG++ R+ ++  T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+  PD  +GFILDG+PR++ QAK+LH  +      IDAV+E RV    +
Sbjct: 61  AELTNQLVDDRLSEPDAANGFILDGFPRSLQQAKALHEMLERRGTDIDAVLEFRVSQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R+DD  +V L R++ YR    PL  YYRD   L  +D +  +
Sbjct: 121 LARLKAR----------GRADDTDEVILNRMKVYRDETAPLLDYYRDQ--LKTVDAVGTL 168

Query: 181 DEV 183
           DEV
Sbjct: 169 DEV 171


>gi|319948702|ref|ZP_08022823.1| adenylate kinase [Dietzia cinnamea P4]
 gi|319437604|gb|EFV92603.1| adenylate kinase [Dietzia cinnamea P4]
          Length = 181

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 121/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KL VP +STGD+ RA + + T LGK+ KG +++G+L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAALLSEKLGVPHISTGDLFRANISQGTDLGKEAKGYIDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V  RI  PD + GF+LDGYPR+V QA +L   +S   C++DAV+E +V+D ++
Sbjct: 61  AEVTNRMVKARISEPDAEEGFLLDGYPRSVAQADALKEMLSEAGCSLDAVLEFKVDDDTV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R DD  DV   R+  YR    PL  YY   G +  ID + ++
Sbjct: 121 VQRMLAR----------GREDDTEDVIRNRMSVYRSETAPLLEYY--AGDVKSIDAVGEV 168

Query: 181 DEV-SRSIDSL 190
           +E+ +R++ +L
Sbjct: 169 EEINARALAAL 179


>gi|326404316|ref|YP_004284398.1| adenylate kinase [Acidiphilium multivorum AIU301]
 gi|325051178|dbj|BAJ81516.1| adenylate kinase [Acidiphilium multivorum AIU301]
          Length = 224

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L  +  V Q++TGDMLRAEV   T LG+  K  MESG+L+S
Sbjct: 1   MNIILLGPPGAGKGTQAKILQDRYGVAQIATGDMLRAEVKAGTELGRAAKAVMESGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R+  PDC +GFILDG+PRTV QA++L   ++     +DAVI L+V++A +
Sbjct: 61  DEIIIGMLRNRLSQPDCRNGFILDGFPRTVPQAQALDTMLAEQKFDLDAVILLKVDEAVL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTI 158
            +RI  R                     V +   S   V R DDK +V   R+  Y    
Sbjct: 121 VERISGRFTCAHCGAGYHDKFHPTSVPGVCDKCGSHDFVRRPDDKAEVVKDRLVAYNAQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+  YY   G L+++DGM  MD+V+  I+  L
Sbjct: 181 APILPYYEQKGRLHVVDGMAAMDQVTAEIEGAL 213


>gi|84494765|ref|ZP_00993884.1| adenylate kinase [Janibacter sp. HTCC2649]
 gi|84384258|gb|EAQ00138.1| adenylate kinase [Janibacter sp. HTCC2649]
          Length = 186

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 115/191 (60%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+++   +P +STGD+ RA +   T LGKQV+    +G  +S
Sbjct: 1   MRLIILGPPGAGKGTQAARIAEHFGIPAISTGDIFRANIKNGTDLGKQVQEITAAGGYVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V DR+   DC+ GF+LDGYPRT  Q  +L A ++  D  +D V+ L V++ ++
Sbjct: 61  DDITNAIVEDRLAQDDCEPGFLLDGYPRTTGQVTALEAMLAKHDHGLDKVLALTVDEDAV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      +E   R+DD  DV  +R   YR+   PL   Y + G L  +DG+ ++
Sbjct: 121 VGRLLKR------AEIEGRADDTEDVIRERQAIYRRETAPLVEVYGERGLLVEVDGLGEV 174

Query: 181 DEVSRSIDSLL 191
           DEV+  I S L
Sbjct: 175 DEVTERIISAL 185


>gi|148260918|ref|YP_001235045.1| adenylate kinase [Acidiphilium cryptum JF-5]
 gi|166219976|sp|A5FZU4|KAD_ACICJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|146402599|gb|ABQ31126.1| Adenylate kinase [Acidiphilium cryptum JF-5]
          Length = 224

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L  +  V Q++TGDMLRAEV   T LG+  K  MESG+L+S
Sbjct: 1   MNIILLGPPGAGKGTQAKILQDRYGVAQIATGDMLRAEVKAGTELGRAAKAVMESGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R+  PDC +GFILDG+PRTV QA++L   ++     +DAVI L+V++A +
Sbjct: 61  DEIIIGMLRNRLSQPDCRNGFILDGFPRTVPQAEALDTMLAEQKFDLDAVILLKVDEAVL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTI 158
            +RI  R                     V +   S   V R DDK +V   R+  Y    
Sbjct: 121 VERISGRFTCAHCGAGYHDKFHPTGVPGVCDKCGSHDFVRRPDDKAEVVKDRLVAYNAQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+  YY   G L+++DGM  MD+V+  I+  L
Sbjct: 181 APILPYYEQKGRLHVVDGMAAMDQVTAEIEGAL 213


>gi|308231621|ref|ZP_07413180.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu001]
 gi|308369975|ref|ZP_07419761.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu002]
 gi|308370483|ref|ZP_07421708.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu003]
 gi|308375236|ref|ZP_07443226.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu007]
 gi|308376483|ref|ZP_07668284.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu008]
 gi|308377502|ref|ZP_07479417.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu009]
 gi|308379851|ref|ZP_07487847.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu011]
 gi|308396520|ref|ZP_07492351.2| adenylate kinase adk [Mycobacterium tuberculosis SUMu012]
 gi|308216733|gb|EFO76132.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu001]
 gi|308325724|gb|EFP14575.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu002]
 gi|308331878|gb|EFP20729.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu003]
 gi|308347034|gb|EFP35885.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu007]
 gi|308350918|gb|EFP39769.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu008]
 gi|308355608|gb|EFP44459.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu009]
 gi|308363471|gb|EFP52322.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu011]
 gi|308367107|gb|EFP55958.1| adenylate kinase adk [Mycobacterium tuberculosis SUMu012]
          Length = 178

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 119/188 (63%), Gaps = 13/188 (6%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPG+GKGTQA +L++KL +PQ+STG++ R  ++  T LG + K  +++G L+   +
Sbjct: 1   MLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDL 60

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
            N++V DR+  PD  +GFILDGYPR+V+QAK+LH  +      IDAV+E RV +  + +R
Sbjct: 61  TNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLER 120

Query: 124 IQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEV 183
           ++ R           R+DD  DV L R++ YR    PL  YYRD   L  +D +  MDEV
Sbjct: 121 LKGR----------GRADDTDDVILNRMKVYRDETAPLLEYYRDQ--LKTVDAVGTMDEV 168

Query: 184 -SRSIDSL 190
            +R++ +L
Sbjct: 169 FARALRAL 176


>gi|209964061|ref|YP_002296976.1| adenylate kinase [Rhodospirillum centenum SW]
 gi|226743896|sp|B6IRS7|KAD_RHOCS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|209957527|gb|ACI98163.1| adenylate kinase [Rhodospirillum centenum SW]
          Length = 215

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 125/215 (58%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA RL +   + QLSTGDMLRA V   + LG++    M++G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAQRLERTRGMVQLSTGDMLRALVRSGSPLGQRADAIMKAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++ +++ DRI  PDC  GFILDG+PRTV QA++L   ++     +D VIE+ V+DA++
Sbjct: 61  DEVMIEMISDRIEQPDCAKGFILDGFPRTVVQAEALDRMLAEKGLRLDHVIEMVVDDAAL 120

Query: 121 FKRIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTI 158
            +RI  R   A                       ++E + R+DD  +   KR+E Y +  
Sbjct: 121 TERITGRFTCAKCGTGYHDTFKRPAQDGVCDVCGSTEFTRRADDNAETVGKRLEAYHRQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+  YY D G L  +DGM D+ EV+R I++++  
Sbjct: 181 APILPYYADRGVLKKVDGMADIAEVARQIEAIIAG 215


>gi|227497202|ref|ZP_03927450.1| adenylate kinase [Actinomyces urogenitalis DSM 15434]
 gi|226833333|gb|EEH65716.1| adenylate kinase [Actinomyces urogenitalis DSM 15434]
          Length = 190

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 118/191 (61%), Gaps = 6/191 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ LGPPG+GKGTQA R+S++L +P +STGD+ RA V  NT LG+Q K  M++G  + D+
Sbjct: 1   MVLLGPPGAGKGTQAARISERLGIPAISTGDIFRANVAGNTELGQQAKKYMDAGEYVPDS 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V DR+   D   GF+LDGYPRT  Q   L A ++    A+D V+E+  E   + +
Sbjct: 61  VTNAMVKDRLAADDAAQGFLLDGYPRTEAQVHELDAMLAESGLALDVVLEITAEAEVVVQ 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R     A+E++ R+DD   V  +R+E Y +   PL++ Y   G L  +DG+ D+DE
Sbjct: 121 RLLKR-----ATEQN-RADDTEPVIRRRLEVYAEQTEPLAALYESKGLLVRVDGIGDIDE 174

Query: 183 VSRSIDSLLVS 193
           V+  I S L S
Sbjct: 175 VTERIMSALAS 185


>gi|240167748|ref|ZP_04746407.1| adenylate kinase [Mycobacterium kansasii ATCC 12478]
          Length = 181

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 119/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +L++KL +PQ+STG++ R  ++  T LG + K  + +G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLAEKLGIPQISTGELFRRNIEDGTKLGIEAKRYLSAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V DR+  PD  +GFILDGYPR+V+QAK+LH  +      IDAV+E RV +  +
Sbjct: 61  SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEGVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV L R++ YR    PL  YY     L  +D +  M
Sbjct: 121 LERLKGR----------GRADDTDDVILNRMKVYRDETAPLLEYYSSQ--LKTVDAVGTM 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|95930501|ref|ZP_01313237.1| adenylate kinases [Desulfuromonas acetoxidans DSM 684]
 gi|95133541|gb|EAT15204.1| adenylate kinases [Desulfuromonas acetoxidans DSM 684]
          Length = 216

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (57%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA  L ++L+VPQ+STGD+LRA V   T +G + KG M++G L+ 
Sbjct: 1   MKLILLGPPGAGKGTQAKTLVERLSVPQISTGDILRAAVKEGTPMGVKAKGFMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R++  DC SGFILDG+PRTV QA +L A ++ +   +D+VI L V+  ++
Sbjct: 61  DEVVVGIVEERLQKEDCASGFILDGFPRTVPQADALSATLTTLGKELDSVISLEVDTEAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    E   R DDK +    R+  Y +  L
Sbjct: 121 VMRLAGRRTCKACGAGYHIEFEPPQKDGVCDKCGGELIQRDDDKEETIRNRMAVYLEQTL 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DGML +DEV  +I  +L
Sbjct: 181 PLVDYYEKAGVLAQVDGMLPIDEVRAAIFEIL 212


>gi|222148387|ref|YP_002549344.1| adenylate kinase [Agrobacterium vitis S4]
 gi|254806965|sp|B9JVQ8|KAD_AGRVS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|221735375|gb|ACM36338.1| adenylate kinase [Agrobacterium vitis S4]
          Length = 216

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+  K  +PQLSTGDMLRA V   T +GK+ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRIVDKYGIPQLSTGDMLRAAVSAQTEVGKRAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI   DC +GFILDG+PRT+ QA +    ++     + AV+E+RVED  +
Sbjct: 61  DDIVIAIVSERIDQDDCSNGFILDGFPRTLIQADATEKMLAVKGLELSAVVEIRVEDEIL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                  +E +     ++    R DD  D    R++ Y K  
Sbjct: 121 ADRIAGRYTCANCGTGYHDENLKPKVEGVCDKCGSTHFKRRPDDNRDTVKTRLQAYYKET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L+ +DGM ++D+V+  I+++L
Sbjct: 181 SPLIGYYYAKGKLHSVDGMAEIDQVTAEIETVL 213


>gi|257054491|ref|YP_003132323.1| Adenylate kinase [Saccharomonospora viridis DSM 43017]
 gi|256584363|gb|ACU95496.1| Adenylate kinase [Saccharomonospora viridis DSM 43017]
          Length = 184

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 13/190 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA  LSQ+L VP +STGD+ R  V   T LG++ K  ++SG L+ D
Sbjct: 3   RVVLVGPPGAGKGTQAATLSQRLGVPHISTGDLFRKHVGEGTPLGREAKRYLDSGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V +R+  PD  SGF+LDG+PR   QA  L   +     ++DAVIEL+V +  + 
Sbjct: 63  TVTNEMVRERLAEPDAQSGFLLDGFPRNTKQADVLGEILEENGHSLDAVIELKVPEDELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+  R           R+DD  +V  +R + YR    PL  YY D+  L  +DG+ D+D
Sbjct: 123 KRLLGR----------GRADDTEEVIRRRQQVYRSETAPLLEYYSDI--LVTVDGIGDVD 170

Query: 182 EVS-RSIDSL 190
           EVS R +D+L
Sbjct: 171 EVSARVLDAL 180


>gi|90417746|ref|ZP_01225658.1| Adenylate kinase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337418|gb|EAS51069.1| Adenylate kinase [Aurantimonas manganoxydans SI85-9A1]
          Length = 217

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 122/213 (57%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL +   +PQLSTGDMLRA V   + +G + K  M+SG+L+S
Sbjct: 1   MRLILLGPPGAGKGTQAQRLIETHKIPQLSTGDMLRAAVTAQSEVGLKAKAVMDSGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V +RI   DC  GFILDGYPRT++QA ++ A +      +D VIE++V+D  +
Sbjct: 61  DDIVNAIVSERIDQADCAEGFILDGYPRTLNQADAVEAMLERKGLKLDHVIEIKVDDDIL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             R+  R                  +E +     +++   R DD  +    R+ +Y K  
Sbjct: 121 VNRVSGRFSCASCGAVYHDEDKRPKVEGVCDVCGSTDFKRRPDDNAETMRTRLRSYYKDT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM  +D V+ SI+ ++
Sbjct: 181 SPLVGYYHCKGTLRAVDGMQPIDVVTESIERIV 213


>gi|24213460|ref|NP_710941.1| adenylate kinase [Leptospira interrogans serovar Lai str. 56601]
 gi|45658682|ref|YP_002768.1| adenylate kinase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|11386897|sp|Q9XD15|KAD_LEPIN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|68568780|sp|Q72NI2|KAD_LEPIC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|24194230|gb|AAN47959.1|AE011262_25 adenylate kinase [Leptospira interrogans serovar Lai str. 56601]
 gi|45601926|gb|AAS71405.1| adenylate kinase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 187

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 118/190 (62%), Gaps = 6/190 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           IIF+GPPG+GKGTQA  L ++L++PQ+STGD+LR  V   T +G + K  M++G L+ D+
Sbjct: 4   IIFMGPPGAGKGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V  ++ DRIR  DC +GF+LDG+PRTV+QA++L   + N   +ID  I L+V DA + K
Sbjct: 64  VVIGIIKDRIREADCKNGFLLDGFPRTVEQAEALDTLLKNEGKSIDKAINLQVPDAELLK 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +E   R+DD       R++NY K  LPL  +Y     L  ++G+  ++E
Sbjct: 124 RLLGR------AEIEGRADDNEVTIKNRLDNYNKKTLPLLDFYATRKKLSQVNGVGSLEE 177

Query: 183 VSRSIDSLLV 192
           V+  I   L 
Sbjct: 178 VTSLIQKELA 187


>gi|313903131|ref|ZP_07836525.1| Adenylate kinase [Thermaerobacter subterraneus DSM 13965]
 gi|313466633|gb|EFR62153.1| Adenylate kinase [Thermaerobacter subterraneus DSM 13965]
          Length = 216

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 116/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR IFLGPPG+GKGTQA RL+Q+  VPQ++TGDM RA V   T LG + K  ME+G L+ 
Sbjct: 1   MRWIFLGPPGAGKGTQAARLAQRAGVPQIATGDMFRAAVREGTPLGLEAKRYMEAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC  GF+LDG+PRTV QA+ L+  ++ +   +D V+   V DA +
Sbjct: 61  DQVTLGLVRERLAQPDCRKGFLLDGFPRTVPQAEGLNEVLAGLGARLDGVLYFDVPDAVV 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
            +R+   RV  A  +   V                    RSDD+ +   +R+  YR+   
Sbjct: 121 VERLSGRRVCPACGATYHVRFEPPQVEGRCDRCGAELVQRSDDREETVRQRLAVYRQQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR+ G L+ +D    +D V   I
Sbjct: 181 PLVRYYREAGLLHTVDAGRPIDAVEAEI 208


>gi|10954728|ref|NP_066663.1| hypothetical protein pRi1724_p083 [Agrobacterium rhizogenes]
 gi|8918728|dbj|BAA97793.1| riorf82 [Agrobacterium rhizogenes]
 gi|10567392|dbj|BAB16201.1| riorf82 [Agrobacterium rhizogenes]
          Length = 194

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 119/199 (59%), Gaps = 5/199 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPGSGKGTQA R+ +KL +P LSTGD+LRAEV   T LG  V  +M +G L+S
Sbjct: 1   MRLILMGPPGSGKGTQAKRICEKLGIPHLSTGDILRAEVKAGTPLGLAVAATMAAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  V+ +V  RI  P+   GF+LDG+PRT+ QA +L   +   + ++ AVIEL V +  +
Sbjct: 61  DDTVSAIVASRIAGPEAQRGFVLDGFPRTISQAAALDQSLG--EHSLTAVIELVVPEEEL 118

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           + RI  R  E+  ++   R+DD       R++ YR   L +S +Y+     + IDG+   
Sbjct: 119 YDRICRRAAESAGAQ---RADDNAATLELRLKAYRAETLSVSEFYKGRSPYFQIDGLAAP 175

Query: 181 DEVSRSIDSLLVSVRKKCS 199
           +EV+  I  LL S   + S
Sbjct: 176 EEVTARILELLESAAAEYS 194


>gi|20808640|ref|NP_623811.1| adenylate kinase [Thermoanaerobacter tengcongensis MB4]
 gi|22653800|sp|Q8R7X4|KAD_THETN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|20517274|gb|AAM25415.1| Adenylate kinase and related kinases [Thermoanaerobacter
           tengcongensis MB4]
          Length = 221

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 119/217 (54%), Gaps = 21/217 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQALKIAKEFDIPHISTGDIFRQNLRDNTELGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR + QA+ L  F+     ++ AVI ++VE  ++
Sbjct: 61  DEVTNRIVEDRLEKEDCKKGFLLDGYPRNIPQAEELDKFLEERGHSLTAVINIQVEREAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R                     V +   SE   RSDDK +  +KR+E Y K   
Sbjct: 121 IDRITGRRVCPVCGATYHIKTSPPKVDNVCDKCGSELIQRSDDKLESVVKRLEVYEKETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  YY   G L  IDG   +DEV   I   L+  R+
Sbjct: 181 PLIDYYTKKGILVNIDGNKSIDEVFEDIKKALLGDRR 217


>gi|126736627|ref|ZP_01752367.1| adenylate kinase [Roseobacter sp. CCS2]
 gi|126713940|gb|EBA10811.1| adenylate kinase [Roseobacter sp. CCS2]
          Length = 195

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL +K N+ QLSTGDMLRA     T +G  V   M+ G L++
Sbjct: 1   MNIILLGPPGAGKGTQAARLVEKRNMVQLSTGDMLRAARTSGTEMGNMVAAVMDRGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++       G+I DG+PRT+ QA +L   +  M   +DAVIEL+V+D  +
Sbjct: 61  DEIVIGLIREQLESDQGKGGYIFDGFPRTLAQADALGNLLVEMGENLDAVIELQVDDDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  EA A+ + VR+DD  +    R+  Y K   PL  YY   G L  +DG+  M
Sbjct: 121 VERIVGRAKEAEAAGQPVRADDNEESLRVRLMAYYKQTSPLIGYYHAKGDLQSVDGLASM 180

Query: 181 DEVSRSIDSLL 191
           D+V+ SI S L
Sbjct: 181 DDVATSIASAL 191


>gi|111023117|ref|YP_706089.1| adenylate kinase [Rhodococcus jostii RHA1]
 gi|110822647|gb|ABG97931.1| adenylate kinase [Rhodococcus jostii RHA1]
          Length = 181

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 121/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KL VP +STGD+ RA + + T LG + K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKLGVPHISTGDLFRANIGQATPLGLEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             I N +V  R+  PD  +GF+LDG+PRTVDQA++L A ++ ++  +DAV+   V++  +
Sbjct: 61  SEITNNMVKARVGEPDAANGFLLDGFPRTVDQAQALEAILAELNTKLDAVLSFIVDEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DDK DV   R+  YR+   PL  YY+D   L  +D + ++
Sbjct: 121 VERMLAR----------GRADDKEDVIRNRLRVYREETAPLLDYYKDQ--LVTVDALGEV 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVNARALAAL 179


>gi|225181163|ref|ZP_03734609.1| Nucleoside-triphosphate--adenylate kinase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168132|gb|EEG76937.1| Nucleoside-triphosphate--adenylate kinase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 215

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQ  RL +K N+P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MRIVLLGPPGAGKGTQGERLVKKYNIPHISTGDIFRAAIKEGTELGLKAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R++ PDCD+G++LDG+PRT+ QA++L   +  M   +  V+ + V+   +
Sbjct: 61  DELVVNIVKERLKQPDCDNGYLLDGFPRTLAQAEALDEALQEMGTPLTGVVNVDVDQEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   RSDD  +   +R+E Y     
Sbjct: 121 VERLTGRRVCRSCGSSFHVQFNPPKVRSVCDKCGGELYQRSDDTVETVKQRLEVYNNQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY + G L+ +DG  D+DEV + I S+L
Sbjct: 181 PLIKYYDEKGILFTVDGSKDIDEVFKEITSVL 212


>gi|197104717|ref|YP_002130094.1| adenylate kinase [Phenylobacterium zucineum HLK1]
 gi|238690126|sp|B4R8N8|KAD_PHEZH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|196478137|gb|ACG77665.1| adenylate kinase [Phenylobacterium zucineum HLK1]
          Length = 190

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 118/194 (60%), Gaps = 6/194 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++  + QLSTGDMLRA +   + LG++V G ME G L+S
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEQRRMVQLSTGDMLRAAIASGSELGQRVSGIMERGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV +++  R+   +   G I DG+PRT+ QA++L A ++     ID V+ L+V+DA++
Sbjct: 61  DAIVIELIEQRLPEAEAAGGAIFDGFPRTLAQAEALDAMLAGRGRRIDLVVRLKVDDAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  E      S R+DD  + F  R++ Y +   PL  YY   G L  +DGM  +
Sbjct: 121 MQRIAGRFAE------SGRADDNPESFKVRLDAYNRQTAPLLPYYEGQGKLVEVDGMGSI 174

Query: 181 DEVSRSIDSLLVSV 194
           D+V+ +ID+ L   
Sbjct: 175 DQVAAAIDAALTGA 188


>gi|190404396|ref|YP_001961027.1| rcorf52 [Agrobacterium rhizogenes]
 gi|158322192|gb|ABW33609.1| rcorf52 [Agrobacterium rhizogenes]
          Length = 194

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 120/199 (60%), Gaps = 5/199 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPGSGKGTQA R+ +KL +P LSTGD+LRAEV   T LG  V  +M +G L+S
Sbjct: 1   MRLILMGPPGSGKGTQAKRICEKLGIPHLSTGDILRAEVKAGTPLGLAVAATMAAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  V+ +V +RI  P+   GF+LDG+PRT+ QA SL   +   + ++ AVIEL V +  +
Sbjct: 61  DDTVSAIVANRIASPEAQRGFVLDGFPRTISQAASLDQSLG--EHSLTAVIELVVPEEEL 118

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           + RI  R  E+  ++   R+DD       R++ YR   L +S +Y+     + +DG+   
Sbjct: 119 YDRICRRAAESAGAQ---RADDNAATLELRLKAYRAETLSVSEFYKGRSPYFQVDGLAVP 175

Query: 181 DEVSRSIDSLLVSVRKKCS 199
           +EV+  I  +L S   + S
Sbjct: 176 EEVTARILEILESAAAEYS 194


>gi|190575733|ref|YP_001973578.1| adenylate kinase [Stenotrophomonas maltophilia K279a]
 gi|229487649|sp|B2FT48|KAD_STRMK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|190013655|emb|CAQ47290.1| putative adenylate kinase (fragment) [Stenotrophomonas maltophilia
           K279a]
          Length = 187

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 115/187 (61%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL +KL +  +STGDMLRAE+   T LGKQ K  M++G+L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKEKLEIAHISTGDMLRAEIAAGTELGKQAKTVMDAGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+  PD   GFILDGYPR V QA ++   ++ +   +DAV++L V    +
Sbjct: 61  DDILLGMLESRLTQPDVAKGFILDGYPRNVAQANAMDGLLAKIGQPLDAVVQLDVATELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      +++  R+DD  +   +R++ Y     P+  +Y   G L  +DG+ ++
Sbjct: 121 VERIAGR------AKEQGRADDTPEAVRQRLQVYNDQTAPVVDFYAGRGTLARVDGVGEL 174

Query: 181 DEVSRSI 187
           DE+   I
Sbjct: 175 DEIEARI 181


>gi|322418385|ref|YP_004197608.1| adenylate kinase [Geobacter sp. M18]
 gi|320124772|gb|ADW12332.1| adenylate kinase [Geobacter sp. M18]
          Length = 216

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 119/216 (55%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG GKGTQA  L  +  +PQ+STGD+LRA V   T +G + KG M+SG+L+ 
Sbjct: 1   MNLILLGPPGVGKGTQAKLLIDRFGIPQISTGDILRAAVKELTPMGIKAKGFMDSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+  PDC  GFILDG+PRTV QA +L   +S M+  ID V+ L V+ A +
Sbjct: 61  DEVVIGIVEERLAQPDCQKGFILDGFPRTVPQADALGQVLSGMNKNIDHVVSLSVDKAEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + +A   E   R DD+ +  L R+  Y     
Sbjct: 121 LKRLTGRRACSKCGAGYHVDFAPSAVAGICDACGGELFQREDDREETILNRLAVYEAQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL SYY+  G L  +DG+  ++ +   I ++L  VR
Sbjct: 181 PLISYYQGAGLLRSVDGLGSVEGIQSEIVAVLQGVR 216


>gi|320533213|ref|ZP_08033928.1| adenylate kinase [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134577|gb|EFW26810.1| adenylate kinase [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 195

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 115/192 (59%), Gaps = 6/192 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ LGPPG+GKGTQA R++++L +P +STGD+ RA V   T LG Q K  M+ G  + D
Sbjct: 4   RMVLLGPPGAGKGTQAARIAERLGIPAISTGDIFRANVAGATELGTQAKAYMDKGEYVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           +I N +V DRI   DC +GF+LDGYPRT  Q   L + + N   A+D V+E+  +  ++ 
Sbjct: 64  SITNAMVADRIAQADCRAGFLLDGYPRTTAQVGELDSMLKNSSLALDVVVEITADAEAVV 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A E+  R+DD   V  +R+E Y ++  PL+  Y + G L  +DGM ++D
Sbjct: 124 ARLLKR-----AGEQG-RADDTEPVIRRRLEVYAESTAPLADIYDERGLLVQVDGMGEID 177

Query: 182 EVSRSIDSLLVS 193
            V+  I   L +
Sbjct: 178 VVTDRIMEALAA 189


>gi|116327245|ref|YP_796965.1| adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116327285|ref|YP_797005.1| adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116332101|ref|YP_801819.1| adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|122280169|sp|Q04PV9|KAD_LEPBJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|116119989|gb|ABJ78032.1| Adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116120029|gb|ABJ78072.1| Adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125790|gb|ABJ77061.1| Adenylate kinase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 187

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 6/190 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           IIF+GPPG+GKGTQA  L  +L++PQ+STGD+LR  V   T +G + K  M++G L+ D+
Sbjct: 4   IIFMGPPGAGKGTQAKILCARLSIPQISTGDILREAVKNQTPMGIEAKRYMDAGDLVPDS 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V  ++ DRIR  DC +GF+LDG+PRTV+QA +L A + N   +ID  I L V D  + K
Sbjct: 64  VVIGIIKDRIREADCKNGFLLDGFPRTVEQADALDALLKNEGKSIDKAINLEVPDGELLK 123

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +E   R+DD       R++NY K  LPL  +Y     L  ++G+  ++E
Sbjct: 124 RLLGR------AEIEGRADDNEATIKNRLDNYNKKTLPLLDFYAAQKKLSQVNGVGTLEE 177

Query: 183 VSRSIDSLLV 192
           V+  I   LV
Sbjct: 178 VTSLIQRELV 187


>gi|269798529|ref|YP_003312429.1| adenylate kinase [Veillonella parvula DSM 2008]
 gi|282849885|ref|ZP_06259268.1| adenylate kinase [Veillonella parvula ATCC 17745]
 gi|294792815|ref|ZP_06757962.1| adenylate kinase [Veillonella sp. 6_1_27]
 gi|294794569|ref|ZP_06759705.1| adenylate kinase [Veillonella sp. 3_1_44]
 gi|303230146|ref|ZP_07316915.1| adenylate kinase [Veillonella atypica ACS-134-V-Col7a]
 gi|303231223|ref|ZP_07317961.1| adenylate kinase [Veillonella atypica ACS-049-V-Sch6]
 gi|269095158|gb|ACZ25149.1| adenylate kinase [Veillonella parvula DSM 2008]
 gi|282580322|gb|EFB85722.1| adenylate kinase [Veillonella parvula ATCC 17745]
 gi|294454899|gb|EFG23272.1| adenylate kinase [Veillonella sp. 3_1_44]
 gi|294456714|gb|EFG25077.1| adenylate kinase [Veillonella sp. 6_1_27]
 gi|302514130|gb|EFL56134.1| adenylate kinase [Veillonella atypica ACS-049-V-Sch6]
 gi|302515207|gb|EFL57180.1| adenylate kinase [Veillonella atypica ACS-134-V-Col7a]
          Length = 187

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (60%), Gaps = 8/184 (4%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA RL +K  +PQ+STGDM RA +   T LG + K  +++G L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAARLIEKYGIPQISTGDMFRAAIKNETPLGVEAKKYIDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V DR+   DC SGFILDG+PRT  QA SL A +  +  ++DAV+ L V    +
Sbjct: 61  DSVTVGIVRDRLVKDDCKSGFILDGFPRTTAQAVSLDAILKELGISLDAVLNLNVPSEEL 120

Query: 121 FKRIQVR-VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
            KRI  R VLE        R+DD  +   KR+  Y ++  PL  YYR+ G    I+G+ D
Sbjct: 121 VKRISERAVLEN-------RADDNPETVQKRLAVYEESTKPLIDYYRNSGLYQEINGLQD 173

Query: 180 MDEV 183
           +D V
Sbjct: 174 VDAV 177


>gi|238018644|ref|ZP_04599070.1| hypothetical protein VEIDISOL_00479 [Veillonella dispar ATCC 17748]
 gi|237865115|gb|EEP66405.1| hypothetical protein VEIDISOL_00479 [Veillonella dispar ATCC 17748]
          Length = 187

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 112/184 (60%), Gaps = 8/184 (4%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA RL +K  +PQ+STGDM RA +   T LG + K  +++G L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAARLIEKYGIPQISTGDMFRAAIKNETPLGVEAKKYIDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V DR+   DC SGFILDG+PRT  QA SL A +  +  ++DAV+ L V    +
Sbjct: 61  DSVTVGIVRDRLVKDDCKSGFILDGFPRTTAQAVSLDAILKELGISLDAVLNLNVPSEEL 120

Query: 121 FKRIQVR-VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
            KRI  R VLE        R+DD  +   KR+  Y ++  PL  YYR+ G    I+G+ D
Sbjct: 121 VKRISERAVLEN-------RADDNPETVQKRLAVYEESTKPLIDYYRNSGLYEEINGLQD 173

Query: 180 MDEV 183
           +D V
Sbjct: 174 VDAV 177


>gi|309812445|ref|ZP_07706200.1| adenylate kinase [Dermacoccus sp. Ellin185]
 gi|308433750|gb|EFP57627.1| adenylate kinase [Dermacoccus sp. Ellin185]
          Length = 192

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 117/197 (59%), Gaps = 6/197 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL++   +P +STGD+ R  +   T LG +VK  + SG  ++
Sbjct: 1   MRLIILGPPGAGKGTQAERLAESRGIPHISTGDIFRTNIKNETELGLKVKDILASGGYVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N++V +R+   D  +GF+LDGYPRT  Q  +L   ++    A+DA +EL V+   +
Sbjct: 61  DEITNEIVKNRLDEADAANGFLLDGYPRTAGQVVALEEMLAAKGQALDAALELTVDGEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E S R+DD  +V  +R E Y +   PL++ Y + G L  +DGM  +
Sbjct: 121 VQRLLKR------AETSGRADDTEEVIRERQELYVRETAPLAAAYTERGLLVQVDGMGSI 174

Query: 181 DEVSRSIDSLLVSVRKK 197
           DEV   I++ L  V  K
Sbjct: 175 DEVEARINAALDEVAAK 191


>gi|83949767|ref|ZP_00958500.1| Adenylate kinase [Roseovarius nubinhibens ISM]
 gi|83837666|gb|EAP76962.1| Adenylate kinase [Roseovarius nubinhibens ISM]
          Length = 191

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 117/191 (61%), Gaps = 1/191 (0%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L Q+ ++ QLSTGDMLR   D  T +GK V   M  G L++
Sbjct: 1   MNIILLGPPGAGKGTQAQLLVQERDMIQLSTGDMLREAKDSGTEMGKIVADVMARGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++   D   GFI DG+PRT+ QA +L   ++    ++DAVIE++V+D ++
Sbjct: 61  DEIVIGLIREKLD-GDRKGGFIFDGFPRTLAQADALAGLLAEKGESLDAVIEMQVDDETL 119

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KRI  R  EA A+ K VR+DD  D    R+  Y K   PL  YY   G L  +DG+  +
Sbjct: 120 VKRIVNRAEEARAAGKPVRADDNADSVRIRLMEYYKKTAPLIGYYHAKGQLKSVDGLGAI 179

Query: 181 DEVSRSIDSLL 191
           DEV  +I SLL
Sbjct: 180 DEVRGAIGSLL 190


>gi|325294417|ref|YP_004280931.1| Adenylate kinase [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325064865|gb|ADY72872.1| Adenylate kinase [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 187

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 119/192 (61%), Gaps = 11/192 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++++FLGPPG+GKGTQA R+++K NVP +STGD+LRA V   T LGK  K  M+ G L+ 
Sbjct: 2   LKVVFLGPPGAGKGTQAVRIAEKYNVPHISTGDILRAAVKEGTELGKLAKEYMDKGELVP 61

Query: 61  DAIVNQVVCDRIRLPDC-DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D ++  ++ +R+   D  + GFILDG+PRT+ QA++L   ++ +   +D V+ L V+D  
Sbjct: 62  DDVIIGIIRERLSQSDVRERGFILDGFPRTLPQAEALDKMLAELGLPLDKVVYLNVDDEE 121

Query: 120 MFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
           + KR+  R           R+DD  +V   R+E YRK   PL  YY + G L  I G+ +
Sbjct: 122 IVKRLLAR----------GRADDTEEVIRNRLEVYRKQTAPLIDYYSEKGILVEICGVGE 171

Query: 180 MDEVSRSIDSLL 191
           +DE+++ I+  L
Sbjct: 172 IDEITKKIEESL 183


>gi|288957443|ref|YP_003447784.1| adenylate kinase [Azospirillum sp. B510]
 gi|288909751|dbj|BAI71240.1| adenylate kinase [Azospirillum sp. B510]
          Length = 215

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 121/215 (56%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA RL     + QLSTGDMLRA V     LG+Q K  M +G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQARRLEDTRGLVQLSTGDMLRAMVAEGGPLGQQAKEIMAAGKLMP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +RI  PD  +GFILDG+PRTV QA++L   +      +D VIE+RV D  +
Sbjct: 61  DELMVSMIAERISKPDVKNGFILDGFPRTVAQAEALDKMLDEKGLKLDHVIEMRVVDDVL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
            +RI  R                  +E +     ++E   R+DD  +    R+  Y +  
Sbjct: 121 VERITGRYTCAKCGKGYHDSFEKPKVEGVCDACGSTEFKRRADDNAETVTTRLAQYHQQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+  YY+  G L  +DGM D+DEV+R I+++LV+
Sbjct: 181 APILPYYQGRGVLKAVDGMADIDEVTRQIETILVN 215


>gi|167645599|ref|YP_001683262.1| adenylate kinase [Caulobacter sp. K31]
 gi|189046008|sp|B0T2E3|KAD_CAUSK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|167348029|gb|ABZ70764.1| adenylate kinase [Caulobacter sp. K31]
          Length = 189

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 117/191 (61%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++  + QLSTGDMLRA +   + LG++VKG ++ G L++
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEQRGMVQLSTGDMLRAAIASGSELGQKVKGVLDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DR+   +   G I DG+PRTV QA++L A ++     ID+V+ L+V++ ++
Sbjct: 61  DEIVIALIEDRLPEAEAAGGAIFDGFPRTVPQAQALDAMLARRGQKIDSVLRLKVDEPAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  E        R DD  +VF+ R+  Y     PL  YYR+ G L  +DGM  +
Sbjct: 121 IERISKRFAE------QGRPDDNPEVFVTRLAAYNAQTAPLLPYYREQGKLTELDGMASV 174

Query: 181 DEVSRSIDSLL 191
           + V+ SID+ L
Sbjct: 175 ETVAGSIDAAL 185


>gi|313893159|ref|ZP_07826736.1| adenylate kinase [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442512|gb|EFR60927.1| adenylate kinase [Veillonella sp. oral taxon 158 str. F0412]
          Length = 187

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 113/188 (60%), Gaps = 8/188 (4%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA RL +K  +PQ+STGDM RA +   T LG + K  +++G L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAARLIEKYGIPQISTGDMFRAAIKNETPLGVEAKKYIDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V DR+   DC SGFILDG+PRT  QA SL A +  +  ++DAV+ L V    +
Sbjct: 61  DSVTVGIVRDRLVKDDCKSGFILDGFPRTTAQAVSLDAILKELGISLDAVLNLNVPTEEL 120

Query: 121 FKRIQVR-VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
            KRI  R VLE        R+DD  +   KR+  Y ++  PL  YYR+ G    I+G+ D
Sbjct: 121 VKRISERAVLEN-------RADDNPETVQKRLAVYDESTKPLIDYYRNSGLYEEINGLQD 173

Query: 180 MDEVSRSI 187
           +D V   I
Sbjct: 174 VDAVFADI 181


>gi|269124089|ref|YP_003306666.1| adenylate kinase [Streptobacillus moniliformis DSM 12112]
 gi|268315415|gb|ACZ01789.1| adenylate kinase [Streptobacillus moniliformis DSM 12112]
          Length = 213

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 118/207 (57%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  GPPG+GKGTQA  L +K  +PQ+STGD+LRA +   T LG + K  M++G+L+ 
Sbjct: 1   MNIVLFGPPGAGKGTQAKELIKKFEIPQISTGDILRAAIANQTPLGLEAKKLMDAGNLVG 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V +R++  D + GFILDGYPRTV+QAK+L   +   +  I+ VI L VED  +
Sbjct: 61  DDIVNGLVEERLKEADTEKGFILDGYPRTVEQAKALDKILEKQERTIEKVIALVVEDDEI 120

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            KRI  R                 ++    +   R+DD  +V  KR+ENY+    P+  Y
Sbjct: 121 LKRITGRRVSKKTGKIYHIIYNPPVDENPEDLEQRADDTAEVVKKRLENYKNQTAPVLEY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y++ G +  I G  +   ++  I  +L
Sbjct: 181 YKNQGKVSEIQGERESKYITEEIIDIL 207


>gi|118616606|ref|YP_904938.1| adenylate kinase [Mycobacterium ulcerans Agy99]
 gi|166980337|sp|A0PM98|KAD_MYCUA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|118568716|gb|ABL03467.1| adenylate kinase (ATP-AMP transphosphorylase), Adk [Mycobacterium
           ulcerans Agy99]
          Length = 181

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 119/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +L++KL +PQ+STG++ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLAEKLGIPQISTGELFRKNIQDGTKLGVEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+  PD  +GFILDGYPR+V+QAK+LH  +   D  IDAV+E RV    +
Sbjct: 61  SDLTNQLVDDRLDQPDTAAGFILDGYPRSVEQAKALHEMLRRRDTDIDAVLEFRVSQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  +V L R++ YR    PL  +Y     +  +D +  +
Sbjct: 121 LQRLKGR----------GRADDTDEVILNRMKVYRDETAPLLEFYDTE--VKTVDAIGTL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|183981091|ref|YP_001849382.1| adenylate kinase (ATP-AMP transphosphorylase), Adk [Mycobacterium
           marinum M]
 gi|238689223|sp|B2HCV5|KAD_MYCMM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|183174417|gb|ACC39527.1| adenylate kinase (ATP-AMP transphosphorylase), Adk [Mycobacterium
           marinum M]
          Length = 181

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 119/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +L++KL +PQ+STG++ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQKLAEKLGIPQISTGELFRKNIQDGTKLGIEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+  PD  +GFILDGYPR+V+QAK+LH  +   D  IDAV+E RV    +
Sbjct: 61  SDLTNQLVDDRLDQPDTAAGFILDGYPRSVEQAKALHEMLRRRDTDIDAVLEFRVSQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  +V L R++ YR    PL  +Y     +  +D +  +
Sbjct: 121 LQRLKGR----------GRADDTDEVILNRMKVYRDETAPLLEFYDT--EVKTVDAIGTL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|118166470|gb|ABK67367.1| adenylate kinase [Mycobacterium avium 104]
          Length = 177

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 116/187 (62%), Gaps = 13/187 (6%)

Query: 5   FLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIV 64
            LGPPG+GKGTQA +LS+KL +PQ+STG++ R+ ++  T LG + K  +++G L+   + 
Sbjct: 1   MLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAKRYLDAGDLVPAELT 60

Query: 65  NQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRI 124
           NQ+V DR+  PD  +GFILDG+PR++ QAK+LH  +      IDAV+E RV    +  R+
Sbjct: 61  NQLVDDRLSEPDAANGFILDGFPRSLQQAKALHEMLERRGTDIDAVLEFRVSQDELLARL 120

Query: 125 QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEV- 183
           + R           R+DD  +V L R++ YR    PL  YYRD   L  +D +  +DEV 
Sbjct: 121 KAR----------GRADDTDEVILNRMKVYRDETAPLLDYYRDQ--LKTVDAVGTLDEVF 168

Query: 184 SRSIDSL 190
           +R++ +L
Sbjct: 169 ARALRAL 175


>gi|226365616|ref|YP_002783399.1| adenylate kinase [Rhodococcus opacus B4]
 gi|226244106|dbj|BAH54454.1| adenylate kinase [Rhodococcus opacus B4]
          Length = 181

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 121/191 (63%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KL VP +STGD+ RA + + T LG + K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKLGVPHISTGDLFRANIGQATPLGLEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             I N +V  R+  PD  +GF+LDG+PRTVDQA++L A ++ ++  +DAV+   V++  +
Sbjct: 61  SEITNNMVKARVGEPDAANGFLLDGFPRTVDQAQALEAILAELNTKLDAVLSFIVDEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DDK DV   R+  YR+   PL  +Y++   L  +D + ++
Sbjct: 121 VERMLAR----------GRADDKEDVIRNRLRVYREETAPLLDHYKEQ--LVTVDALGEV 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVNARALAAL 179


>gi|15827979|ref|NP_302242.1| adenylate kinase [Mycobacterium leprae TN]
 gi|221230456|ref|YP_002503872.1| adenylate kinase [Mycobacterium leprae Br4923]
 gi|13431601|sp|O33007|KAD_MYCLE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806998|sp|B8ZS96|KAD_MYCLB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|13093532|emb|CAC30786.1| probable adenylate kinase [Mycobacterium leprae]
 gi|219933563|emb|CAR71928.1| probable adenylate kinase [Mycobacterium leprae Br4923]
          Length = 181

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 118/191 (61%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA RL++KL +PQ+STG++ R  ++++T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQRLAEKLGIPQISTGELFRRNIEKDTKLGHEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+   D   GFILDGYPR+++QAK+LH  +      IDAV+E RV  A +
Sbjct: 61  ADLTNQLVDDRLNKSDTVDGFILDGYPRSLEQAKALHEMLERRGTDIDAVLEFRVSQAVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV + R+  YR     L  YY     L  ID +  M
Sbjct: 121 LERLKGR----------GRADDTDDVVINRMNIYRDETASLLEYYS--SELKTIDAIGTM 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALHAL 179


>gi|330993869|ref|ZP_08317801.1| Adenylate kinase [Gluconacetobacter sp. SXCC-1]
 gi|329759137|gb|EGG75649.1| Adenylate kinase [Gluconacetobacter sp. SXCC-1]
          Length = 219

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 124/219 (56%), Gaps = 22/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M IIFLGPPG+GKGTQ+ RL ++  + Q+STGDMLRAEV  ++ LG+QVK  M  G L+ 
Sbjct: 1   MNIIFLGPPGAGKGTQSKRLEERYGIAQISTGDMLRAEVAADSPLGQQVKTIMAEGRLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RIR PDC  GFILDG+PRT  QA++L   ++     IDAV+ L V++ ++
Sbjct: 61  DDLIIAMIEKRIRQPDCAKGFILDGFPRTRAQAEALDTMLARSGQHIDAVLLLDVDEDAL 120

Query: 121 FKRIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R   A                         E   R DD+ +    R++ YR+  
Sbjct: 121 ADRIAGRYTCAKCGAGYNDVFKRPKVEGTCDVCGGHEFIRREDDRRETVAARLKTYRELT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
            P+  YY +   LY IDGM D+D V++ + +++  + KK
Sbjct: 181 APILPYYEEEKRLYRIDGMADIDAVTQEVFAVIDRITKK 219


>gi|2344858|emb|CAB11460.1| adenylate kinase [Mycobacterium leprae]
          Length = 181

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 118/191 (61%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA RL++KL +PQ+STG++ R  ++++T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQRLAEKLGIPQISTGELFRRNIEKDTKLGHEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + NQ+V DR+   D   GFILDGYPR+++QAK+LH  +      IDAV+E RV  A +
Sbjct: 61  ADLTNQLVDDRLNKSDTVDGFILDGYPRSLEQAKALHEMLERRGTDIDAVLEFRVSQAVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R           R+DD  DV + R+  YR     L  YY     L  ID +  M
Sbjct: 121 LERLKGR----------GRADDTDDVVINRMNIYRDETRSLLEYYS--SELKTIDAIGTM 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALHAL 179


>gi|254455539|ref|ZP_05068968.1| adenylate kinase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082541|gb|EDZ59967.1| adenylate kinase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 187

 Score =  150 bits (379), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 114/192 (59%), Gaps = 8/192 (4%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  GPPG+GKGTQ+  L  KLN  Q+STGD+LR E+ +N+ +GKQ+   M  G  IS
Sbjct: 1   MNIILFGPPGAGKGTQSKYLVNKLNNFQISTGDILRDEIKKNSDIGKQITNDMNDGIFIS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN++V   +  P     FI DGYPR++ QAK+L   ++N +  ID +  L V   ++
Sbjct: 61  DDIVNELVEKLVNDPQKKDRFIFDGYPRSLSQAKNLDDLLNNSNQKIDHIFFLNVNKETI 120

Query: 121 FKRIQVR-VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
            KRI+ R VLE        RSDD  +  +KR + Y +T  P+  +Y      + IDG  +
Sbjct: 121 IKRIEKRKVLEN-------RSDDDMNTIIKRYDTYMETTKPVLDFYSKNPNFHEIDGTQE 173

Query: 180 MDEVSRSIDSLL 191
           +DE++R ID+ +
Sbjct: 174 IDEITRKIDNFI 185


>gi|84685397|ref|ZP_01013295.1| adenylate kinase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666554|gb|EAQ13026.1| adenylate kinase [Rhodobacterales bacterium HTCC2654]
          Length = 191

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 117/191 (61%), Gaps = 1/191 (0%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L  + N+ QLSTGDMLR      T +G +V   M++G L++
Sbjct: 1   MNIILLGPPGAGKGTQAKKLVDERNMIQLSTGDMLREARTSGTEMGNKVAAIMDAGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++   D   GFI DG+PRT+ QA +L   ++    ++D VIE++V+D ++
Sbjct: 61  DEIVIGLIAEKLE-GDNAGGFIFDGFPRTLGQADALGKLLAEKGASLDHVIEMQVDDETL 119

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R  EA  + + VR+DD  +    R+  Y K   PL  YY   G L  IDG+  +
Sbjct: 120 VQRVVNRAKEAAEAGQPVRADDNAESMRTRLMEYYKKTSPLIGYYYAKGDLKSIDGLASI 179

Query: 181 DEVSRSIDSLL 191
           DEV+ SI ++L
Sbjct: 180 DEVAGSIKAIL 190


>gi|56696688|ref|YP_167049.1| adenylate kinase [Ruegeria pomeroyi DSS-3]
 gi|56678425|gb|AAV95091.1| adenylate kinase [Ruegeria pomeroyi DSS-3]
          Length = 222

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 113/211 (53%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  GKQ K  ME+G L+SD 
Sbjct: 7   LILLGPPGAGKGTQARMLEEKFGLVQLSTGDLLRAAVAAGTPAGKQAKAVMEAGDLVSDE 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   +S     I+A I L VED  M  
Sbjct: 67  IVIAILRDRLAEPDCAKGVILDGFPRTTVQAEALDTLLSESGQRINAAISLEVEDGEMVT 126

Query: 123 RIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                        +   +E   R+DD  +    R+E Y     P
Sbjct: 127 RISGRYTCGGCGEGYHDTFKQPAEAGKCDKCGGTEMKRRADDNAETVASRLEAYHAQTAP 186

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L +YY   G L  ID M ++DE+++ + +++
Sbjct: 187 LIAYYDGHGVLQRIDAMGEIDEIAQGLATIV 217


>gi|225026382|ref|ZP_03715574.1| hypothetical protein EUBHAL_00631 [Eubacterium hallii DSM 3353]
 gi|224956271|gb|EEG37480.1| hypothetical protein EUBHAL_00631 [Eubacterium hallii DSM 3353]
          Length = 213

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +LS+K  +P +STGD+ RA +  NT LG++ KG M++G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKLSEKYGIPHISTGDIFRANIKNNTELGQKAKGYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI+  DC  GFILDG+PRT+ QA++L   ++N +  ID  I + V D ++
Sbjct: 61  DELVVDLVVDRIKEKDCFKGFILDGFPRTIPQAEALDYALNNQNEKIDYAINVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    +  +R DDK +   KR++ Y     
Sbjct: 121 INRMGGRRACVGCGATYHVVNMPPKKEGICDHCGEKLVLREDDKPETVKKRLQVYHDQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG LD++ V   I  +L
Sbjct: 181 PLIEYYDKKGSLLTVDGTLDINVVFEKITEVL 212


>gi|254525244|ref|ZP_05137299.1| adenylate kinase [Stenotrophomonas sp. SKA14]
 gi|219722835|gb|EED41360.1| adenylate kinase [Stenotrophomonas sp. SKA14]
          Length = 187

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 114/187 (60%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL +KL +  +STGDMLRAE+   T LGKQ K  M++G+L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKEKLGIAHISTGDMLRAEIAAGTELGKQAKTVMDAGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA ++   ++ +   +DAV++L V    +
Sbjct: 61  DDILLGMLESRLTQADVAKGFILDGYPRNVAQANAMDGLLAKIGQPLDAVVQLDVATELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      +++  R+DD  +   +R++ Y     P+  +Y   G L  +DG+ ++
Sbjct: 121 VERIAGR------AKEQGRADDTPEAVRQRLQVYNDQTAPVVDFYAGRGTLARVDGVGEL 174

Query: 181 DEVSRSI 187
           DE+   I
Sbjct: 175 DEIEARI 181


>gi|206901449|ref|YP_002250721.1| adenylate kinase [Dictyoglomus thermophilum H-6-12]
 gi|206740552|gb|ACI19610.1| adenylate kinase [Dictyoglomus thermophilum H-6-12]
          Length = 215

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 113/206 (54%), Gaps = 22/206 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           IIFLGPPG+GKGT A  +SQ LN+P +STGD+ R  V   T LG +VK  ++SGSL+ D 
Sbjct: 5   IIFLGPPGAGKGTHAKEVSQILNIPHISTGDIFREHVKNQTELGIKVKSYLDSGSLVPDE 64

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V +VV DRI   DC +GFILDG+PRT+ QA+ L  ++   +  I  VI L   D  + K
Sbjct: 65  LVWEVVKDRISKEDCKNGFILDGFPRTIPQAEMLEKYLKEKNAVI-KVIYLDASDELVIK 123

Query: 123 RIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPL 161
           R+  R                     + +    E   RSDDK +V  +R+E Y K   PL
Sbjct: 124 RLSARRVCKNCGAIYNLISMPPKKDGICDICGGELYQRSDDKPEVIKQRLETYYKETQPL 183

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSI 187
             YYR+ G +Y I    + +EV   I
Sbjct: 184 IDYYRNKGIMYTISAEKEREEVLNEI 209


>gi|114767222|ref|ZP_01446087.1| Adenylate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114540632|gb|EAU43703.1| Adenylate kinase [Roseovarius sp. HTCC2601]
          Length = 192

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 115/191 (60%), Gaps = 1/191 (0%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L ++  + QLSTGDMLR      + +GK+V   M++G L++
Sbjct: 1   MNIILLGPPGAGKGTQAGFLVEERGMVQLSTGDMLREAKASGSEMGKRVAAIMDAGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ ++++     SGFI DG+PRT+ QA +L   ++ M  ++D VIELRV D ++
Sbjct: 61  DEIVIGLIREKLQTTKA-SGFIFDGFPRTLKQADALGELLTEMGQSLDKVIELRVNDEAL 119

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R   AIA+ +  R+DD  +   KR+  Y K   PL  YY   G    IDGM  M
Sbjct: 120 VDRIVGRAEAAIAAGEKPRADDNAESLKKRLMEYYKQTSPLIGYYYAKGMYSRIDGMASM 179

Query: 181 DEVSRSIDSLL 191
           DEV  ++ + L
Sbjct: 180 DEVKAALGAKL 190


>gi|261338258|ref|ZP_05966142.1| adenylate kinase [Bifidobacterium gallicum DSM 20093]
 gi|270276913|gb|EFA22767.1| adenylate kinase [Bifidobacterium gallicum DSM 20093]
          Length = 206

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +   T LGK+     + G L+ 
Sbjct: 16  MRLLIMGPQGVGKGTQAALLSEHYEIPAISTGDIFRYNIKNQTELGKEALAYTDKGELVP 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+ + D  +G+ILDGYPR   Q  +L   +  +   +DAV+ L  +   +
Sbjct: 76  DELTNKIVKDRLAMDDAKNGWILDGYPRNASQVAALDVMLEELGVELDAVVALEADRDVL 135

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+Q R     A+E+  RSDD  +V  KR+E Y K   PL + YR+ G L   DG+ D+
Sbjct: 136 MERMQKR-----AAEQG-RSDDTPEVIAKRLETYEKETAPLLNIYRERGLLLAFDGVGDI 189

Query: 181 DEVSRSI 187
           DE+S++I
Sbjct: 190 DEISKTI 196


>gi|218135260|ref|ZP_03464064.1| hypothetical protein BACPEC_03165 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990645|gb|EEC56656.1| hypothetical protein BACPEC_03165 [Bacteroides pectinophilus ATCC
           43243]
          Length = 213

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYSIPHISTGDIFRANIKNGTELGKKAKTYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++V  +V DR + PDC +G++LDG+PRT+ QA++L   +  +   +D  I + V D ++
Sbjct: 61  DSLVVDLVIDRFKEPDCANGYVLDGFPRTIPQAEALDEALKAIGEKVDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +A   +  +R DDK +    R++ Y K   
Sbjct: 121 INRMSGRRACVGCGATYHIKYNPTKVEGICDACGEKLILRDDDKPETVKNRLDVYHKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G +  +DG +DMDEV  SI  +L
Sbjct: 181 PLIDYYAKQGIMKEVDGTVDMDEVFNSIVKIL 212


>gi|319789259|ref|YP_004150892.1| adenylate kinase [Thermovibrio ammonificans HB-1]
 gi|317113761|gb|ADU96251.1| adenylate kinase [Thermovibrio ammonificans HB-1]
          Length = 187

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 116/192 (60%), Gaps = 11/192 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++++FLGPPG+GKGTQA R++ K  VP +STGD+LRA V   T LGK  K  M+ G L+ 
Sbjct: 2   IKVVFLGPPGAGKGTQAQRIAAKYGVPHISTGDILRAAVKEGTELGKLAKTYMDRGELVP 61

Query: 61  DAIVNQVVCDRIRLPDC-DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D ++  ++ +R+  PD  + GFILDG+PRT+ QAK+L   +  ++  +D VI L V+D  
Sbjct: 62  DDVIIGIIRERLSEPDVKEKGFILDGFPRTIAQAKALDQMLEELNMPLDRVIYLNVDDEE 121

Query: 120 MFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
           + KR+  R           R DD  +V  KR++ YR+   PL  YY +   L  I G+ D
Sbjct: 122 IVKRLLAR----------GREDDTEEVIRKRLKVYREQTAPLIDYYSEKCLLVEIYGVGD 171

Query: 180 MDEVSRSIDSLL 191
           +DE++  I+  L
Sbjct: 172 IDEITAKIEEAL 183


>gi|255263393|ref|ZP_05342735.1| adenylate kinase [Thalassiobium sp. R2A62]
 gi|255105728|gb|EET48402.1| adenylate kinase [Thalassiobium sp. R2A62]
          Length = 192

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 111/191 (58%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L    N+ QLSTGDMLR      T +GK V   M+ G L++
Sbjct: 1   MNIILLGPPGAGKGTQAQKLVDSRNMIQLSTGDMLREAKTSGTEMGKMVAAVMDRGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++       GFI DG+PRT+ QA +L   ++ M   +D V+EL+V D  +
Sbjct: 61  DEIVIGLIREKLEAGGATGGFIFDGFPRTLAQADALGDLLTEMGQTLDDVVELQVNDEVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  EA+A+  + R+DD  +    R+  Y K   PL  YY   G L  +DG+  M
Sbjct: 121 VERILGRAAEAVAAGGTARADDNEESLKTRLMAYYKQTSPLIGYYYAKGQLQSVDGLDTM 180

Query: 181 DEVSRSIDSLL 191
           D V+ SI  +L
Sbjct: 181 DGVASSISDVL 191


>gi|317123077|ref|YP_004103080.1| adenylate kinase [Thermaerobacter marianensis DSM 12885]
 gi|315593057|gb|ADU52353.1| Adenylate kinase [Thermaerobacter marianensis DSM 12885]
          Length = 216

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 116/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR IFLGPPG+GKGTQA RL+Q+  VPQ++TGDM RA V   T LG Q K  M++G L+ 
Sbjct: 1   MRWIFLGPPGAGKGTQAARLAQRAGVPQIATGDMFRAAVREGTPLGLQAKRYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC +GF+LDG+PRTV QA+ L   ++ +   +D V+   V DA +
Sbjct: 61  DDVTLGLVRERLSQPDCRAGFLLDGFPRTVAQAEGLKDVLAGLGVGLDGVLYFDVPDAVV 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
            +R+   RV  A  +   V                    R DD+ +   +R+  YR+   
Sbjct: 121 VERLSGRRVCPACGATYHVRFDPPRVEGRCDRCGAELVQRPDDREETVRQRLAVYRRQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL +YYR+ G L+ +     +D+V   I
Sbjct: 181 PLVNYYREAGLLHTVAADRPIDQVEAEI 208


>gi|77918336|ref|YP_356151.1| adenylate kinase [Pelobacter carbinolicus DSM 2380]
 gi|123574760|sp|Q3A6M6|KAD_PELCD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|77544419|gb|ABA87981.1| Adenylate kinase [Pelobacter carbinolicus DSM 2380]
          Length = 216

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 121/212 (57%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPGSGKGTQA  LS++L +PQ+STGDMLRA V   T +G + K  M++G+L+ 
Sbjct: 1   MKMILLGPPGSGKGTQAKMLSERLGIPQISTGDMLRAAVKEGTPMGVKAKAKMDAGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DCD GFILDG+PRT+ QA +L   + ++   +DAVI L V++ ++
Sbjct: 61  DEVVVGIVRERLVKDDCDKGFILDGFPRTLPQADALKQTLGDLKKDLDAVISLEVDNDAV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +    +   R DDK +   KR++ Y +   
Sbjct: 121 VGRVAGRRTCRDCGKMYHVEFDAPAVADKCDKCGGQLFQRDDDKEETIRKRLDVYAQQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YYR  G L  IDGM D+  V + I S L
Sbjct: 181 PLIAYYRADGLLRDIDGMKDISGVQQQILSAL 212


>gi|260427037|ref|ZP_05781016.1| adenylate kinase (ATP-AMP transphosphorylase) [Citreicella sp.
           SE45]
 gi|260421529|gb|EEX14780.1| adenylate kinase (ATP-AMP transphosphorylase) [Citreicella sp.
           SE45]
          Length = 232

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 112/211 (53%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L  K  + QLSTGD+LRA V   T  GKQ K  ME+G L+SD 
Sbjct: 16  LILLGPPGAGKGTQARMLEDKFGLVQLSTGDLLRAAVAAGTEAGKQAKAVMEAGGLVSDE 75

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++     IDA + L V+DA+M  
Sbjct: 76  IVIAILRDRLAEPDCARGVILDGFPRTTVQAEALDRLLAETGQKIDAAVSLEVDDAAMVT 135

Query: 123 RIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A                        +E   R+DDK +    R+E Y     P
Sbjct: 136 RISGRYTCAACGEGYHDAFKQPAKAGTCDKCGGTEMKRRADDKAETVASRLEAYHAQTAP 195

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY + G L  ID M  +D ++  + +++
Sbjct: 196 LIGYYEEKGTLSRIDAMGAIDRIAADLGAIV 226


>gi|114766851|ref|ZP_01445778.1| adenylate kinase [Pelagibaca bermudensis HTCC2601]
 gi|114540972|gb|EAU44031.1| adenylate kinase [Roseovarius sp. HTCC2601]
          Length = 228

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 116/211 (54%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L     + QLSTGD+LRA V + T  GKQ K  ME+G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARMLEDTFGLVQLSTGDLLRAAVAQGTEAGKQAKAVMEAGGLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++  +  IDA I L V+DA+M  
Sbjct: 72  IVIAILRDRLAEPDCAKGVILDGFPRTTVQAEALDRLLAESNQQIDAAISLEVDDAAMVT 131

Query: 123 RIQVRVL--------------EAIA--------SEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                 A+A        +E   R+DDK +    R+E Y     P
Sbjct: 132 RISGRYTCGNCGEGYHDSFKQPAMAGVCDKCGGTEMKRRADDKAETVASRLEAYHAQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY + G L  ID M  +D+++  + +++
Sbjct: 192 LIGYYEEKGALTRIDAMGAIDKIAADLGAIV 222


>gi|85706428|ref|ZP_01037522.1| adenylate kinase [Roseovarius sp. 217]
 gi|85669201|gb|EAQ24068.1| adenylate kinase [Roseovarius sp. 217]
          Length = 229

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 117/212 (55%), Gaps = 22/212 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G+Q K  ME+G L+SDA
Sbjct: 14  LVLLGPPGAGKGTQARMLEEQFGLVQLSTGDLLRAAVAAGTEAGRQAKAVMEAGDLVSDA 73

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++ +   I A I L V+DA+M  
Sbjct: 74  IVIAILRDRLSEPDCAGGVILDGFPRTTVQAEALDGLLAEIGQGIRAAISLEVDDAAMVT 133

Query: 123 RIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                  +E        +E   R+DD  +   +R+  Y     P
Sbjct: 134 RISGRYTCGGCGEGYHDSFKVPSVEGTCDKCGGTEMKRRADDNAETVEQRLRAYHAQTAP 193

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
           L SYY   G L  +D M +++ V+R +++++ 
Sbjct: 194 LISYYESRGVLARVDAMAEIEAVARELNAIVA 225


>gi|315652333|ref|ZP_07905325.1| adenylate kinase [Eubacterium saburreum DSM 3986]
 gi|315485456|gb|EFU75846.1| adenylate kinase [Eubacterium saburreum DSM 3986]
          Length = 213

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K N+P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKVAKKYNIPHISTGDIFRANIKEGTELGKRAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   ++ DRI   DC +GF+LDG+PRT+ QAKSL   +S ++  ID  I + V D S+
Sbjct: 61  DDITIGMLLDRIHKADCKNGFVLDGFPRTIPQAKSLSEALSKLNEKIDYAINIDVPDDSI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   SE  +R DDK +   KR++ Y K   
Sbjct: 121 ITRMSGRRACLSCGSTYHIKYSAPKKENICDNCGSELVIRDDDKPETVKKRLDVYHKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY +   L  +DG  DM+EV   I ++L
Sbjct: 181 PLIDYYDNENILANVDGTKDMEEVFLDIVAVL 212


>gi|54022762|ref|YP_117004.1| adenylate kinase [Nocardia farcinica IFM 10152]
 gi|68568753|sp|Q5Z1Q1|KAD_NOCFA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|54014270|dbj|BAD55640.1| putative adenylate kinase [Nocardia farcinica IFM 10152]
          Length = 181

 Score =  148 bits (374), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 115/184 (62%), Gaps = 12/184 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KL VP +STGD+ RA + + T LG++ +  M++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAVLLSEKLGVPHISTGDLFRANISQQTPLGREAQKYMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V  R+  PD  +GF+LDGYPRTVDQA +L   + +M+  +DAV+   V + ++
Sbjct: 61  SDVTNRMVEARVNEPDAANGFVLDGYPRTVDQADALEKILGDMNSKLDAVLCFVVPEDTV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  DV   R+  YR+   PL  +Y   G +  +DG+ ++
Sbjct: 121 VERMLAR----------GRNDDTEDVIRNRMRVYREETEPLLDHYD--GLVVTVDGVGEV 168

Query: 181 DEVS 184
           DEV+
Sbjct: 169 DEVN 172


>gi|329945750|ref|ZP_08293437.1| adenylate kinase [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528198|gb|EGF55176.1| adenylate kinase [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 195

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/192 (39%), Positives = 113/192 (58%), Gaps = 6/192 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ LGPPG+GKGTQA R++++L +P +STGD+ RA V   T LG + K  M+ G  + D
Sbjct: 4   RMVLLGPPGAGKGTQAARIAERLGIPAISTGDIFRANVAGATELGTRAKAYMDKGEYVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           +I N +V DRI   DC +GF+LDGYPRT  Q   L + +     A+D V+E+  +  ++ 
Sbjct: 64  SITNAMVGDRIAQNDCVAGFLLDGYPRTTAQVGELDSMLKTSGLALDVVVEITADAEAVV 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A E+  R+DD   V   R+E Y ++  PL+  Y + G L  +DGM ++D
Sbjct: 124 ARLLKR-----AGEQG-RADDTEPVIRHRLEVYAESTAPLAGIYAERGLLVQVDGMGEID 177

Query: 182 EVSRSIDSLLVS 193
            V+  I   L S
Sbjct: 178 VVTARILEALAS 189


>gi|311744788|ref|ZP_07718584.1| adenylate kinase [Aeromicrobium marinum DSM 15272]
 gi|311311905|gb|EFQ81826.1| adenylate kinase [Aeromicrobium marinum DSM 15272]
          Length = 187

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (59%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  L++ +    +STGD+ RA V   T LG+  +  M++G  + 
Sbjct: 1   MRLLIMGPPGAGKGTQAVGLAEAIGGAHVSTGDIFRANVAEQTELGRTAQQYMDAGEYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  SGF+LDGYPRTVDQ ++L   ++ +D ++DAV+ L V+   +
Sbjct: 61  DEVTNAMVRDRLAQEDARSGFVLDGYPRTVDQVETLDGILAELDSSLDAVVALVVDPEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      +E S R+DD  +V   R E Y     PL + Y + G L  IDG+ D+
Sbjct: 121 IGRLLKR------AETSGRADDTEEVIRHRQEVYAAETAPLLAVYGERGLLREIDGVGDV 174

Query: 181 DEVSRSIDSLL 191
           DE++  I + L
Sbjct: 175 DEIAARITAAL 185


>gi|84515657|ref|ZP_01003018.1| adenylate kinase [Loktanella vestfoldensis SKA53]
 gi|84510099|gb|EAQ06555.1| adenylate kinase [Loktanella vestfoldensis SKA53]
          Length = 192

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 112/191 (58%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L    N+ QLSTGDMLRA     T +GK V   M+ G L++
Sbjct: 1   MNIILLGPPGAGKGTQARKLVDDRNMIQLSTGDMLRAARTSGTAMGKTVAAVMDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++       GFI DG+PRT+ QA +L   ++ M  ++D VIEL+V D  +
Sbjct: 61  DEIVIGLIREQLETGGDHGGFIFDGFPRTLAQADALGDLLAEMGQSLDHVIELQVNDDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R  E +AS    R+DD  D    R+  Y K   PL  YY   G L  +DG+  +
Sbjct: 121 VERVLGRAAETVASGGQARADDNADSLRTRLLAYYKQTSPLIGYYHAKGDLTSLDGLASV 180

Query: 181 DEVSRSIDSLL 191
           D V+ SI ++L
Sbjct: 181 DVVADSIAAVL 191


>gi|254418459|ref|ZP_05032183.1| adenylate kinases subfamily [Brevundimonas sp. BAL3]
 gi|196184636|gb|EDX79612.1| adenylate kinases subfamily [Brevundimonas sp. BAL3]
          Length = 186

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 113/192 (58%), Gaps = 6/192 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++  + QLSTGDMLRA +   + LG +VK  +  G L++
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEERGMVQLSTGDMLRAAIASGSELGLKVKDVLARGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DR+   +   G I DG+PRTV QA++L A ++     IDAV+ L+V+D+++
Sbjct: 61  DEIVIALIEDRLPEAEAAGGAIFDGFPRTVAQAEALDAMLAKRGAQIDAVVRLKVDDSAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R  E        R DD  D F+ R++ Y +   PL  YY   G L   DGM  +
Sbjct: 121 LERIAKRYAE------QGRPDDNPDTFVVRLDAYNRNTAPLLPYYEAQGKLTEADGMGSI 174

Query: 181 DEVSRSIDSLLV 192
           D V+++ID  L 
Sbjct: 175 DSVAKAIDEALA 186


>gi|296282603|ref|ZP_06860601.1| adenylate kinase [Citromicrobium bathyomarinum JL354]
          Length = 215

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 119/213 (55%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +GKQ K  M++G L+S
Sbjct: 1   MNIILLGPPGAGKGTQAHRLVDHHGMRQLSTGDMLRAAVKAGTPVGKQAKAIMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ D +     D+G I DGYPRT  QA+ L A ++     +D VIEL+V++ ++
Sbjct: 61  DDIVSALIDDELASMSADTGAIFDGYPRTRAQAEQLDALLAKHGRKLDRVIELQVDEEAL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                  +E +     ++E   R DD  +    R+E YR   
Sbjct: 121 VDRITGRFTCAACGEGYHDRHKLPQIEGVCDKCGSTEFKRRPDDNEETVRHRMEVYRSET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+  YY + G +  +DGM  ++EVS SID+LL
Sbjct: 181 APILPYYEEQGLVARVDGMGSIEEVSSSIDALL 213


>gi|259416529|ref|ZP_05740449.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter sp.
           TrichCH4B]
 gi|259347968|gb|EEW59745.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter sp.
           TrichCH4B]
          Length = 222

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 120/214 (56%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  GKQ K  M++G L+SD 
Sbjct: 7   LILLGPPGAGKGTQARMLQEKYGLVQLSTGDLLRAAVAAGTEAGKQAKAVMDAGGLVSDE 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC +G ILDG+PRT  QAK+L A +++    I+A I L+V D +M +
Sbjct: 67  IVIAILKDRMDDADCKNGVILDGFPRTTVQAKALDALLASTGQRINAAISLQVNDEAMVE 126

Query: 123 RIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                        +   +E + R+DD+ +    R+E Y     P
Sbjct: 127 RISGRSTCAGCGEGYHDTFKPPLPGDTCAKCGGTELTRRADDRAETVASRLEAYHAQTAP 186

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY D G L  +D M +++ V+  + S++ +V
Sbjct: 187 LITYYGDAGVLQTVDAMEEINRVATQMSSVVETV 220


>gi|326773985|ref|ZP_08233267.1| adenylate kinase (ATP-AMP transphosphorylase) [Actinomyces viscosus
           C505]
 gi|326636124|gb|EGE37028.1| adenylate kinase (ATP-AMP transphosphorylase) [Actinomyces viscosus
           C505]
          Length = 191

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (59%), Gaps = 6/191 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ LGPPG+GKGTQA R++++L++P +STGD+ RA V   T LG Q K  M+ G  + D+
Sbjct: 1   MVLLGPPGAGKGTQAARIAERLSIPAISTGDIFRANVAGATELGTQAKAYMDKGEYVPDS 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           I N +V DRI   DC++GF+LDGYPRT  Q   L + +     A+D V+E+  +  ++  
Sbjct: 61  ITNAMVADRIAQADCENGFLLDGYPRTTAQVGELDSMLKASGLALDVVVEITADAEAVVA 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R     A E+  R+DD   V  +R+E Y ++  PL+  Y +   L  +DGM ++D 
Sbjct: 121 RLLKR-----AGEQG-RADDTEPVIRRRLEVYAESTAPLAGLYAERDLLVQVDGMGEIDV 174

Query: 183 VSRSIDSLLVS 193
           V+  I   L S
Sbjct: 175 VTGRIMEALAS 185


>gi|152964678|ref|YP_001360462.1| adenylate kinase [Kineococcus radiotolerans SRS30216]
 gi|151359195|gb|ABS02198.1| adenylate kinase [Kineococcus radiotolerans SRS30216]
          Length = 191

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 112/190 (58%), Gaps = 6/190 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ LGPPG+GKGTQA  LS +L VP +STGD+ RA V   T LG+ V+  + +G  + D
Sbjct: 3   RLVLLGPPGAGKGTQAKLLSDRLGVPAISTGDIFRANVAEGTELGRTVQEYLNAGKYVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+ NQ+V +R+  PD   GFILDGYPRT DQ + L   ++++   ++ V+E+  +   + 
Sbjct: 63  AVTNQMVRERLAQPDAAEGFILDGYPRTTDQVRELDDMLADVGAKLEHVLEIAADTDELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R +E        RSDD  +V   R + Y +   PL   Y D G L  +DG+ D+ 
Sbjct: 123 RRLAKRAVE------QGRSDDTEEVIRTRQQVYAEQTAPLVEVYSDRGLLRSVDGLGDIP 176

Query: 182 EVSRSIDSLL 191
           EV+  + S L
Sbjct: 177 EVTSRLVSAL 186


>gi|5163225|gb|AAD40604.1|AF115283_23 adenylate kinase [Leptospira interrogans]
          Length = 181

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 115/187 (61%), Gaps = 6/187 (3%)

Query: 6   LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVN 65
           +GPPG+GKGTQA  L ++L++PQ+STGD+LR  V   T +G + K  M++G L+ D++V 
Sbjct: 1   MGPPGAGKGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPDSVVI 60

Query: 66  QVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ 125
            ++ DRIR  DC +GF+LDG+PRTV+QA++L   + N   +ID  I L+V DA + KR+ 
Sbjct: 61  GIIKDRIREADCKNGFLLDGFPRTVEQAEALDTLLKNEGKSIDKAINLQVPDAELLKRLL 120

Query: 126 VRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            R      +E   R+DD       R++NY K  LPL  +Y     L  ++G+  ++EV+ 
Sbjct: 121 GR------AEIEGRADDNEVTIKNRLDNYNKKTLPLLDFYATRKKLSQVNGVGSLEEVTS 174

Query: 186 SIDSLLV 192
            I   L 
Sbjct: 175 LIQKELA 181


>gi|194367074|ref|YP_002029684.1| adenylate kinase [Stenotrophomonas maltophilia R551-3]
 gi|238693431|sp|B4SI37|KAD_STRM5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|194349878|gb|ACF53001.1| adenylate kinase [Stenotrophomonas maltophilia R551-3]
          Length = 187

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 113/187 (60%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL +KL +  +STGDMLRAE+   + LGKQ K  M++G+L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKEKLGIAHISTGDMLRAEIAAGSELGKQAKAVMDAGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA ++   ++ +   +DAV++L V    +
Sbjct: 61  DDILLGMLESRLTQADVAKGFILDGYPRNVAQANAMDGLLAKIGQPLDAVVQLDVATELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R      +++  R+DD  +   +R++ Y     P+  +Y   G L  +DG+ ++
Sbjct: 121 VDRIAGR------AKEQGRADDSPEAVRQRLQVYNDQTAPVVDFYAARGTLARVDGVGEL 174

Query: 181 DEVSRSI 187
           DE+   I
Sbjct: 175 DEIEARI 181


>gi|108798020|ref|YP_638217.1| adenylate kinase [Mycobacterium sp. MCS]
 gi|119867115|ref|YP_937067.1| adenylate kinase [Mycobacterium sp. KMS]
 gi|126433682|ref|YP_001069373.1| adenylate kinase [Mycobacterium sp. JLS]
 gi|123369667|sp|Q1BD73|KAD_MYCSS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980334|sp|A3PVF5|KAD_MYCSJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980335|sp|A1UBR9|KAD_MYCSK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|108768439|gb|ABG07161.1| Adenylate kinase [Mycobacterium sp. MCS]
 gi|119693204|gb|ABL90277.1| Adenylate kinase [Mycobacterium sp. KMS]
 gi|126233482|gb|ABN96882.1| Adenylate kinase [Mycobacterium sp. JLS]
          Length = 181

 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 118/191 (61%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQA +L+ KL VP +STGD+ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRIVLLGPPGAGKGTQAAKLADKLGVPHISTGDLFRDNITNETELGVEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            ++ N +V DRI   D  +GFILDGYPR+V+QA++L   ++  + ++DAVIE RV +  +
Sbjct: 61  SSLTNALVEDRIDQDDAKNGFILDGYPRSVEQAEALGDMLAARNLSLDAVIEFRVSEDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R+DD  +V L R++ YR    PL  +YR    L  +D +  +
Sbjct: 121 LSRLKGR----------GRADDTEEVILNRMKVYRDETAPLLDHYR--AELKTVDAVGSL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALQAL 179


>gi|66810297|ref|XP_638872.1| adenylate kinase [Dictyostelium discoideum AX4]
 gi|74854499|sp|Q54QJ9|KAD2_DICDI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2; AltName:
           Full=Adenylate kinase A
 gi|60467495|gb|EAL65517.1| adenylate kinase [Dictyostelium discoideum AX4]
          Length = 276

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 121/215 (56%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++F+GPPGSGKGTQA  + +   +  LSTGDMLRA +++ T  GKQ K  M+ G L+ 
Sbjct: 29  LRVVFIGPPGSGKGTQAPLVKEDYCLCHLSTGDMLRAAIEQGTETGKQAKTIMDQGGLVP 88

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ + I+ P+C  GFILDG+PRTV QA+ L   ++  +  ID V++  ++D+ +
Sbjct: 89  DEVMVNMIKENIQTPECKKGFILDGFPRTVPQAEKLDKMLAEDNKKIDHVLDFAIDDSLL 148

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KRI  R++                      I  E  + RSDD  +V  KR+E++ K   
Sbjct: 149 VKRITGRLVHPSSGRSYHREFFPPKVDMIDDITGEPLIQRSDDNEEVLKKRLESFHKNTT 208

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           P+  YY++ G L  ID       VS +I S+ +S 
Sbjct: 209 PVLGYYQNKGILSTIDASKSAPFVSHTIKSIFLST 243


>gi|260589257|ref|ZP_05855170.1| adenylate kinase [Blautia hansenii DSM 20583]
 gi|260540338|gb|EEX20907.1| adenylate kinase [Blautia hansenii DSM 20583]
          Length = 228

 Score =  147 bits (370), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 15  MKIIMLGAPGAGKGTQAKKIAEKYGIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 74

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC +G+ILDG+PRT+ QA+SL   +S M   ID  I + V D ++
Sbjct: 75  DELTVDLVIDRVAKEDCKNGYILDGFPRTIPQAESLDVALSKMGEKIDYAINVEVPDENI 134

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +A   +  +R DDK +  LKR+  Y +   
Sbjct: 135 VKRMSGRRACLGCGATYHVEFNAPKTEGVCDACGEKLVLRDDDKEETVLKRLGVYHEQTQ 194

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G +  +DG +D+D V ++I  +L
Sbjct: 195 PLIDYYAKAGVMKEVDGTVDLDAVFQAIVDVL 226


>gi|323691222|ref|ZP_08105498.1| adenylate kinase [Clostridium symbiosum WAL-14673]
 gi|323504741|gb|EGB20527.1| adenylate kinase [Clostridium symbiosum WAL-14673]
          Length = 214

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K  +P +STGD+ R+ +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYQIPHISTGDIFRSNIKEGTELGMKAKQFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI   DC+ G++LDG+PRT+ QA+SL   +S+   AID  I++ V D ++
Sbjct: 61  DEVTIGMLLDRIHQDDCEKGYVLDGFPRTIPQAESLTKALSDRGEAIDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   +E  +R DDK +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLTCGATYHVTFAPPAKEGICDVCGAELVLRDDDKPETVQKRLAVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++ G L+ +DG  DM+EV +SI  +L
Sbjct: 181 PLIDYYKEKGVLHSVDGTKDMEEVFQSITEIL 212


>gi|294630914|ref|ZP_06709474.1| adenylate kinase [Streptomyces sp. e14]
 gi|292834247|gb|EFF92596.1| adenylate kinase [Streptomyces sp. e14]
          Length = 220

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 112/207 (54%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++KL++P +STGD+ RA +   T LGK  K  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAVRLAEKLSIPHISTGDLFRANISGQTELGKLAKSYMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +S     +DAV++L V +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLSGEGITLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  D   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVTYSKPKQEGVCDVCGGELYQRDDDHEDTVRKRLEVYHSQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I  +  +DE++R
Sbjct: 181 EPIIDYYKAQGLVVTISSLGPVDEITR 207


>gi|161378175|ref|NP_297568.2| adenylate kinase [Xylella fastidiosa 9a5c]
 gi|21263756|sp|Q9PGM3|KAD_XYLFA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
          Length = 187

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 112/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA ++ + L +P +STGD+LR+EV   T LG Q K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAAQMKETLQIPHISTGDLLRSEVVAGTPLGLQAKQVMAQGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAI+  ++  R+   D   GFILDGYPR + QA +L   ++ +   ++AV++L V    +
Sbjct: 61  DAILIGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKLGHPLNAVVQLEVPTDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  D   KR++ Y  +  P+  +Y+  G L  +DG+  +
Sbjct: 121 VERIAGR------AQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRGILLRVDGVGRL 174

Query: 181 DEVSRSI 187
           DEVS+ I
Sbjct: 175 DEVSQRI 181


>gi|118473144|ref|YP_885866.1| adenylate kinase [Mycobacterium smegmatis str. MC2 155]
 gi|166980333|sp|A0QSH8|KAD_MYCS2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|118174431|gb|ABK75327.1| adenylate kinase [Mycobacterium smegmatis str. MC2 155]
          Length = 181

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+KL +PQ+STGD+ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAEKLSEKLGIPQISTGDLFRKNIGDGTPLGLEAKRYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V DRI  PD   GFILDGYPR+V+QA +L   ++  +  +DAV+E +V +  +
Sbjct: 61  AELTNRLVEDRIDQPDAAEGFILDGYPRSVEQAGALKDMLAARNTKLDAVLEFQVSEDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R+DD  +V   R++ YR+   PL  YYRD   L  ++ +  +
Sbjct: 121 LTRLKGR----------GRADDTDEVIRNRMKVYREETEPLLEYYRD--DLKTVNAVGAL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALSAL 179


>gi|291460739|ref|ZP_06600129.1| adenylate kinase [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291416698|gb|EFE90417.1| adenylate kinase [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 215

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R++++  +P +STGD+ R+ +   T LGK+ K  ++ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAIRIAERYRIPHVSTGDIFRSNIKGGTELGKKAKDYIDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI  PDC+ G++LDG+PRT+ QA+SL   +      ID  +++ V DA +
Sbjct: 61  DELTIGMLLDRISQPDCEGGYVLDGFPRTIPQAESLKEALEKRGERIDLALDIEVPDAHI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +   SE   RSDDK +    R++ Y +   
Sbjct: 121 VRRMGGRRACPKCGATYHLEFAPPEREGLCDRCGSELITRSDDKAETVQGRLDVYHRQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL SYYR+ G L  IDG    DEV  ++++LL  V
Sbjct: 181 PLISYYREEGILREIDGTKTPDEVFSALEALLSEV 215


>gi|295396449|ref|ZP_06806611.1| adenylate kinase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970751|gb|EFG46664.1| adenylate kinase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 187

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 107/184 (58%), Gaps = 6/184 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA RLS+KL +P +STGD  RA V   T LGK  K  M++G  + 
Sbjct: 1   MRIILIGPPGAGKGTQAARLSEKLGIPAISTGDTFRANVKNETELGKTAKRYMDAGEYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  +GF+LDGYPRT  Q   L   +      +D V+EL  +   +
Sbjct: 61  DEVTNSMVQDRLNQDDTANGFMLDGYPRTEAQVHELDRMLKEASQELDHVVELTADTDEI 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      ++   R+DD  DV   R++ Y +   PL+  Y++ G L  +DG+ ++
Sbjct: 121 VARLLAR------AQIEKRADDTEDVIRHRLDVYVEQTQPLTDIYQERGLLRKVDGLGEI 174

Query: 181 DEVS 184
           DEV+
Sbjct: 175 DEVT 178


>gi|289579122|ref|YP_003477749.1| adenylate kinase [Thermoanaerobacter italicus Ab9]
 gi|289528835|gb|ADD03187.1| adenylate kinase [Thermoanaerobacter italicus Ab9]
          Length = 217

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MKIILLGPPGAGKGTQAVKIAKEFDIPHISTGDIFRQNLRENTDLGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V +R+   DC  GF+LDGYPR V+QA+ L  F+      +D V+ + VE  ++
Sbjct: 61  DEVTNKIVENRLEKNDCQKGFLLDGYPRNVEQAEELDRFLQGKGIHLDCVLNIEVEKEAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +   ++   RSDDK +  +KR+E Y     
Sbjct: 121 IERITGRRVCPNCGATYHIKTFPPAVDNVCDKCGAQLIQRSDDKLESIVKRLEVYESQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y   G L  IDG   ++EV   I  +L
Sbjct: 181 PLIEHYTKKGILVNIDGNKSVEEVFEDIKKVL 212


>gi|9105094|gb|AAF83088.1|AE003881_1 adenylate kinase [Xylella fastidiosa 9a5c]
          Length = 198

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 112/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA ++ + L +P +STGD+LR+EV   T LG Q K  M  G L+S
Sbjct: 12  MRLVLLGPPGSGKGTQAAQMKETLQIPHISTGDLLRSEVVAGTPLGLQAKQVMAQGDLVS 71

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAI+  ++  R+   D   GFILDGYPR + QA +L   ++ +   ++AV++L V    +
Sbjct: 72  DAILIGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKLGHPLNAVVQLEVPTDVL 131

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  D   KR++ Y  +  P+  +Y+  G L  +DG+  +
Sbjct: 132 VERIAGR------AQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRGILLRVDGVGRL 185

Query: 181 DEVSRSI 187
           DEVS+ I
Sbjct: 186 DEVSQRI 192


>gi|331082664|ref|ZP_08331787.1| adenylate kinase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330400283|gb|EGG79925.1| adenylate kinase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 228

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 15  MKIIMLGAPGAGKGTQAKKIAEKYGIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 74

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC +G+ILDG+PRT+ QA+SL A +S     ID  I + V D ++
Sbjct: 75  DELTVDLVIDRVAKEDCKNGYILDGFPRTIPQAESLDAALSKTGEKIDYAINVEVPDENI 134

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +A   +  +R DDK +  LKR+  Y +   
Sbjct: 135 VKRMSGRRACLGCGATYHVEFNVPKTEGVCDACGEKLVLRDDDKEETVLKRLGVYHEQTQ 194

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G +  +DG +D+D V ++I  +L
Sbjct: 195 PLIDYYAKAGVMKEVDGTVDLDAVFQAIVDVL 226


>gi|16125518|ref|NP_420082.1| adenylate kinase [Caulobacter crescentus CB15]
 gi|221234264|ref|YP_002516700.1| adenylate kinase [Caulobacter crescentus NA1000]
 gi|20138513|sp|Q9A8T2|KAD_CAUCR RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806979|sp|B8H4F5|KAD_CAUCN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|13422602|gb|AAK23250.1| adenylate kinase, putative [Caulobacter crescentus CB15]
 gi|220963436|gb|ACL94792.1| adenylate kinase/nucleoside-diphosphate kinase [Caulobacter
           crescentus NA1000]
          Length = 191

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 115/194 (59%), Gaps = 6/194 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL  +  + QLSTGDMLRA +   + LG++VKG ++ G L++
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVTERGMVQLSTGDMLRAAIASGSELGQRVKGVLDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DR+   +   G I DG+PRTV QA++L   ++     ID V+ L+V++ ++
Sbjct: 61  DEIVIALIEDRLPEAEAAGGAIFDGFPRTVAQAEALDKMLAARGQKIDVVLRLKVDEPAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ R       E+  R DD  +VF+ R+  Y     PL  YY   G L  +DGM  +
Sbjct: 121 IERIKKRF------EEQGRPDDNPEVFVTRLAAYNAQTAPLLPYYEGQGKLTELDGMGTV 174

Query: 181 DEVSRSIDSLLVSV 194
           + V+ SIDS L  V
Sbjct: 175 EAVAASIDSALEPV 188


>gi|262038732|ref|ZP_06012092.1| adenylate kinase [Leptotrichia goodfellowii F0264]
 gi|261747284|gb|EEY34763.1| adenylate kinase [Leptotrichia goodfellowii F0264]
          Length = 209

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 117/207 (56%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L++K  +PQ+STGD+LR  + + T LG + K  M+ G+L+S
Sbjct: 1   MNIVLFGAPGAGKGTQAKELTKKYEIPQISTGDILREAIAKKTPLGLEAKKLMDGGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V  R++  DC+ GFILDG+PRTV QA++L   +   +  I+ VI L V D  +
Sbjct: 61  DDIVNGLVEARLQEADCEKGFILDGFPRTVAQAEALDKILEKFNKKIEKVIALDVSDDEI 120

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                 ++    +   R DD  +  +KR+E Y K   P+  Y
Sbjct: 121 IERITGRRVSKKTGKIYHIKYNPPVDEKEEDLEQRVDDNKETVMKRLEVYNKQTAPVLEY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +Y +DG   ++E+++ I  +L
Sbjct: 181 YKKQNKVYSVDGAKKLEEITKDIIDIL 207


>gi|312140897|ref|YP_004008233.1| adenylate kinase [Rhodococcus equi 103S]
 gi|325675465|ref|ZP_08155149.1| adenylate kinase [Rhodococcus equi ATCC 33707]
 gi|311890236|emb|CBH49554.1| adenylate kinase [Rhodococcus equi 103S]
 gi|325553436|gb|EGD23114.1| adenylate kinase [Rhodococcus equi ATCC 33707]
          Length = 181

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (59%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KL VP +STGD+ RA + + T LG + K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKLGVPHISTGDLFRANIGQETPLGLEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             I N +V  R+  PD  +GF+LDG+PRTVDQAK+L   +  +   +D V+   V+D  +
Sbjct: 61  SEITNNMVKARVAEPDAANGFLLDGFPRTVDQAKALEGILEGLGAKLDGVLAFDVDDEVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  DV   R+  YR+   PL  YY   G +  +D +  +
Sbjct: 121 VERMLAR----------GRADDTEDVIRNRMRVYREETAPLLDYY--AGQIVTVDAVGAV 168

Query: 181 DEV-SRSIDSL 190
           +EV +R++ +L
Sbjct: 169 EEVNARALAAL 179


>gi|182628297|sp|Q9HE76|KAD1_NEUCR RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|16944550|emb|CAC18138.2| probable adenylate kinase [Neurospora crassa]
          Length = 278

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 122/223 (54%), Gaps = 22/223 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ +GPPG+GKGTQA ++ +K N   L+TGDMLRA+V + T LGKQ K  M  G L+S
Sbjct: 41  LRMVLMGPPGAGKGTQAPKIKEKFNCCHLATGDMLRAQVAKGTALGKQAKKIMNEGGLVS 100

Query: 61  DAIVNQVVCDRIR-LPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ D +    +C  GFILDG+PRTV QA+ L A +   +  +   +EL+++D+ 
Sbjct: 101 DDIVIGMIKDELENNKECQGGFILDGFPRTVPQAEGLDAMLRERNLPLQHAVELKIDDSL 160

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  +   KR+E Y K  
Sbjct: 161 LVARITGRLVHPASGRSYHRIFNPPKDDMKDDITGEPLVQRSDDNAEALRKRLETYHKQT 220

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
            P+  YY++ G    ID   +  +V +S+ ++    + K SS+
Sbjct: 221 APVVGYYQNTGIWKAIDASQEPAQVWKSLLAIFEGDKAKASSA 263


>gi|120402359|ref|YP_952188.1| adenylate kinase [Mycobacterium vanbaalenii PYR-1]
 gi|166980338|sp|A1T4T2|KAD_MYCVP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|119955177|gb|ABM12182.1| Adenylate kinase [Mycobacterium vanbaalenii PYR-1]
          Length = 181

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 114/191 (59%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQA +L++KL +PQ+STGD+ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRIVLLGPPGAGKGTQAQKLAEKLGIPQISTGDLFRYNISNGTELGLEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N +V DR+   D  +GFILDGYPR+V+QAK+L   +   D ++DAV+E RV +  +
Sbjct: 61  ATLTNALVDDRLDDEDAAAGFILDGYPRSVEQAKALDEMLKKRDLSLDAVLEFRVPEEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R DD  DV   R   YR    PL  YY     L  +D + ++
Sbjct: 121 VSRLKGR----------GRDDDTEDVIRNRFRVYRDETAPLLDYYS--ADLKTVDAVGEL 168

Query: 181 DEV-SRSIDSL 190
           DEV +R++ +L
Sbjct: 169 DEVFARALKAL 179


>gi|121534654|ref|ZP_01666475.1| adenylate kinases [Thermosinus carboxydivorans Nor1]
 gi|121306674|gb|EAX47595.1| adenylate kinases [Thermosinus carboxydivorans Nor1]
          Length = 217

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA +L +  N+P +STGDM RA V   T LGKQ K  M++G L+ 
Sbjct: 1   MHILLMGPPGAGKGTQAVKLVEAFNIPHISTGDMFRAAVKEGTPLGKQAKEYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V +R+  PDC+ GFILDG+PRT+DQA +L   +  +   +D VI + V    +
Sbjct: 61  DSVTIGIVKERLTKPDCERGFILDGFPRTLDQADALDRTLCELGIRLDRVINISVPAEEL 120

Query: 121 FKRI---------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+                     Q  + +    E   R+DD+     KR+  Y     
Sbjct: 121 VRRMTGRRICRSCGATYHIHFNPPAQAGICDKCGGELYQRADDQEQTVTKRLAVYSAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+D G    IDG  D+D+V   I
Sbjct: 181 PLIEYYQDKGLYTEIDGQQDIDKVFADI 208


>gi|88854661|ref|ZP_01129327.1| adenylate kinase [marine actinobacterium PHSC20C1]
 gi|88815822|gb|EAR25678.1| adenylate kinase [marine actinobacterium PHSC20C1]
          Length = 199

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA RL++   +P +STGD+ R+ V   T LG + K  M++G  + D
Sbjct: 3   RLLLIGPPGAGKGTQAARLAEIYGIPAISTGDIFRSNVKNGTELGTKAKAFMDAGDNVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N ++ DR+   D   GF+LDGYPRT DQ + L +F+++   A+DAV+EL  +   + 
Sbjct: 63  SLTNALIRDRLEEDDAQDGFLLDGYPRTTDQVRELDSFLASHGAALDAVVELEADPEVVI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R++ R LE        RSDD   V   R+E Y +   PL + Y     L  ID + ++D
Sbjct: 123 SRLRKRALE------QGRSDDTEAVVRHRLEVYSEQTAPLINVYASRDVLVTIDALGEID 176

Query: 182 EVSRSIDSLLV 192
            V+  I   LV
Sbjct: 177 AVTARITEALV 187


>gi|254294419|ref|YP_003060442.1| adenylate kinase [Hirschia baltica ATCC 49814]
 gi|254042950|gb|ACT59745.1| adenylate kinase [Hirschia baltica ATCC 49814]
          Length = 187

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 114/191 (59%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA +L  +    QLSTGDMLRA     + LG +V   M+SG L+S
Sbjct: 1   MNLILFGPPAAGKGTQAKKLVAERGFVQLSTGDMLRAARSSGSELGLKVSSIMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV +++ +++ L    +GFI DG+PRTV QA++L   +  ++  +D VI L+V+D ++
Sbjct: 61  DEIVIELIKEQLELNSGAAGFIFDGFPRTVPQAEALDKLLETLNSKVDHVIRLKVDDEAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R       E+  R+DD  + F KR++ Y     PL   Y + G L  +DGM  +
Sbjct: 121 MQRIVKRF------EEEGRTDDNPESFRKRLDAYNAQTAPLLPIYAEQGKLTEVDGMQQI 174

Query: 181 DEVSRSIDSLL 191
           D V+R ID +L
Sbjct: 175 DVVAREIDKVL 185


>gi|28198150|ref|NP_778464.1| adenylate kinase [Xylella fastidiosa Temecula1]
 gi|71897742|ref|ZP_00679968.1| Adenylate kinase, subfamily [Xylella fastidiosa Ann-1]
 gi|182680781|ref|YP_001828941.1| adenylate kinase [Xylella fastidiosa M23]
 gi|32129646|sp|Q87ES6|KAD_XYLFT RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238691075|sp|B2I757|KAD_XYLF2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|28056210|gb|AAO28113.1| adenylate kinase [Xylella fastidiosa Temecula1]
 gi|71732297|gb|EAO34351.1| Adenylate kinase, subfamily [Xylella fastidiosa Ann-1]
 gi|182630891|gb|ACB91667.1| adenylate kinase [Xylella fastidiosa M23]
 gi|307579247|gb|ADN63216.1| adenylate kinase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 187

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 111/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA ++ + L +P +STGD+LR+EV   T LG Q K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAAQMQETLQIPHISTGDLLRSEVVAGTPLGLQAKQVMAQGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAI+  ++  R+   D   GFILDGYPR + QA +L   ++     ++AV++L V    +
Sbjct: 61  DAILLGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKFGHPLNAVVQLEVPTDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  D   KR++ Y  +  P+  +Y+  G L  +DG+  +
Sbjct: 121 VERIAGR------AQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRGILLRVDGVGRL 174

Query: 181 DEVSRSI 187
           DEVS+ I
Sbjct: 175 DEVSQRI 181


>gi|323483280|ref|ZP_08088670.1| adenylate kinase [Clostridium symbiosum WAL-14163]
 gi|323403378|gb|EGA95686.1| adenylate kinase [Clostridium symbiosum WAL-14163]
          Length = 214

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K  +P +STGD+ R+ +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYQIPHISTGDIFRSNIKEGTELGMKAKQFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI   DC+ G++LDG+PRT+ QA+SL   +S+   AID  I++ V D ++
Sbjct: 61  DEVTIGMLLDRIHQDDCEKGYVLDGFPRTIPQAESLTKALSDRGEAIDYAIDVDVLDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   +E  +R DDK +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLTCGATYHVTFAPPAKEGICDVCGAELVLRDDDKPETVQKRLAVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++ G L+ +DG  DM+EV +SI  +L
Sbjct: 181 PLIDYYKEKGVLHSVDGTKDMEEVFQSITEIL 212


>gi|284813563|ref|NP_001165387.1| adenylate kinase 2 [Bombyx mori]
 gi|283558275|gb|ADB27115.1| adenylate kinase 2 [Bombyx mori]
          Length = 242

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPGSGKGTQA RL +K  V  LSTGDMLRAEV   + LG+++K  M+ G L+S
Sbjct: 19  IRAVLLGPPGSGKGTQAPRLKEKYCVCHLSTGDMLRAEVSSGSDLGRRLKKVMDEGKLVS 78

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++   +  P+C +GF+LDG+PRTV QA+ L   ++    A+DAVIE  +ED+ +
Sbjct: 79  DEMVVDMIDKNLDQPECKNGFLLDGFPRTVPQAEKLDDLLAKRKTALDAVIEFGIEDSLL 138

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      +  E  + RSDD  +   KR+  Y    +
Sbjct: 139 VRRITGRLIHPPSGRSYHEEFHPPKKPMTDDVTGEALIKRSDDNVEALKKRLATYHAQTV 198

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY   G  + +D     D+V   ID++  S
Sbjct: 199 PLVDYYMRKGLHWRVDASKAADDVFNKIDNIFKS 232


>gi|239980035|ref|ZP_04702559.1| adenylate kinase [Streptomyces albus J1074]
 gi|291451892|ref|ZP_06591282.1| adenylate kinase [Streptomyces albus J1074]
 gi|291354841|gb|EFE81743.1| adenylate kinase [Streptomyces albus J1074]
          Length = 218

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 115/206 (55%), Gaps = 22/206 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGKQ K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLSIPHISTGDLFRANISQGTELGKQAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD ++GF+LDG+PR V QAK+L   +     A+DAV++L V +  +
Sbjct: 61  DEVTIGMAEDRMAQPDAENGFLLDGFPRNVSQAKALDESLKAQGVALDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R+DDK +   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVEYSKPETEGVCDVCGGELYQRADDKEETVRKRLEVYHNET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS 184
            P+  +Y+  G +  I  +  +DEV+
Sbjct: 181 EPIIDHYKAQGLVVTISALGKVDEVT 206


>gi|71275715|ref|ZP_00652000.1| Adenylate kinase, subfamily [Xylella fastidiosa Dixon]
 gi|71897829|ref|ZP_00680055.1| Adenylate kinase, subfamily [Xylella fastidiosa Ann-1]
 gi|170729464|ref|YP_001774897.1| adenylate kinase [Xylella fastidiosa M12]
 gi|238687910|sp|B0U1U0|KAD_XYLFM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|71163606|gb|EAO13323.1| Adenylate kinase, subfamily [Xylella fastidiosa Dixon]
 gi|71732384|gb|EAO34438.1| Adenylate kinase, subfamily [Xylella fastidiosa Ann-1]
 gi|167964257|gb|ACA11267.1| adenylate kinase [Xylella fastidiosa M12]
          Length = 187

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 111/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA ++ + L +P +STGD+LR+EV   T LG Q K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAAQMKETLQIPHISTGDLLRSEVVAGTPLGLQAKQVMAQGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAI+  ++  R+   D   GFILDGYPR + QA +L   ++     ++AV++L V    +
Sbjct: 61  DAILIGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKFGHPLNAVVQLEVPTDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  D   KR++ Y  +  P+  +Y+  G L  +DG+  +
Sbjct: 121 VERIAGR------AQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRGILLRVDGVGRL 174

Query: 181 DEVSRSI 187
           DEVS+ I
Sbjct: 175 DEVSQRI 181


>gi|213404974|ref|XP_002173259.1| adenylate kinase Adk1 [Schizosaccharomyces japonicus yFS275]
 gi|212001306|gb|EEB06966.1| adenylate kinase Adk1 [Schizosaccharomyces japonicus yFS275]
          Length = 220

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 121/216 (56%), Gaps = 22/216 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA ++ +K  +  L+TGDMLR++V R T LGK+ K  M+ G+L+S
Sbjct: 4   MRLILVGPPGAGKGTQAPKIKEKYGIAHLATGDMLRSQVARQTELGKEAKKIMDQGNLVS 63

Query: 61  DAIVNQVVCDR-IRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ D  +  P+C +GFILDG+PRTV QA+ L A ++ M   ++ V+EL+V+D  
Sbjct: 64  DEIVVGMIKDELLNNPECKNGFILDGFPRTVVQAEKLDALLAEMKLELNTVVELQVDDEL 123

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           + +RI  R++                      +  E  V RSDD  D   KR+ NY +  
Sbjct: 124 LVRRITGRLVHPASGRSYHVEFNPPKVPMTDDVTGEPLVQRSDDNADALRKRLVNYHEQT 183

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
            P+  YY+       I      ++V   I++ L  V
Sbjct: 184 APVVDYYKGKNKWSPIAAAQAPEKVWEQIEAALKKV 219


>gi|258542048|ref|YP_003187481.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633126|dbj|BAH99101.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636183|dbj|BAI02152.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639238|dbj|BAI05200.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642292|dbj|BAI08247.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645347|dbj|BAI11295.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648402|dbj|BAI14343.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651455|dbj|BAI17389.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654446|dbj|BAI20373.1| adenylate kinase [Acetobacter pasteurianus IFO 3283-12]
          Length = 222

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M IIFLGPPG+GKGTQ+  L ++  + Q+STGDMLRAEV + +  GKQ K  M++G L+ 
Sbjct: 1   MNIIFLGPPGAGKGTQSKLLEERYGLIQISTGDMLRAEVAKGSETGKQAKALMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RI   DC +GFILDG+PRT+ QA+ L + +S+    ID V+ L V++  +
Sbjct: 61  DELIIAMLKSRIAQADCQNGFILDGFPRTLAQAEELDSMLSSDGKKIDTVLFLDVDEEIL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                  +E +     + E   R+DDK +  ++R++ YRK  
Sbjct: 121 ADRISGRFTCGNCGKTYNEVSNPPKVEGVCDSCGSHEFKRRADDKRETVVERLKEYRKLT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+  +Y   G L+ I+GML   EV+  I+  L S
Sbjct: 181 APILPFYEKTGRLHKINGMLSASEVTGEIEDALAS 215


>gi|197117344|ref|YP_002137771.1| adenylate kinase [Geobacter bemidjiensis Bem]
 gi|226743879|sp|B5EFS1|KAD_GEOBB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|197086704|gb|ACH37975.1| adenylate kinase [Geobacter bemidjiensis Bem]
          Length = 214

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG GKGTQA  L  +  +PQ+STGD+LRA V   T +G + KG M+SG+L+ 
Sbjct: 1   MNLILLGPPGVGKGTQAKLLIDRFGIPQISTGDILRAAVKELTPMGAKAKGYMDSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DC  GFILDG+PRTV QA +L   +S M  +ID V+ L V+   +
Sbjct: 61  DEVVIGIVEERLAQADCQKGFILDGFPRTVPQADALGQVLSGMGKSIDHVVSLSVDKGEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +A + +   R DDK +  L R+  Y     
Sbjct: 121 LKRLTGRRACANCGAGYHVDFAPSKVAGVCDACSGQLVQREDDKEETILNRLAVYEAQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL +YY+  G L  +DG+  ++ V   I
Sbjct: 181 PLIAYYQAAGLLRSVDGLGTVEGVQSGI 208


>gi|298253056|ref|ZP_06976848.1| adenylate kinase [Gardnerella vaginalis 5-1]
 gi|297532451|gb|EFH71337.1| adenylate kinase [Gardnerella vaginalis 5-1]
          Length = 188

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 111/191 (58%), Gaps = 7/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +  +T LGKQV+G ++ G L+ 
Sbjct: 3   MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNLKNHTELGKQVQGYLDKGELVP 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  SG+ILDGYPR   Q ++L   +  +   +D V+ L  E   +
Sbjct: 63  DELTNSIVKDRLAQDDAKSGWILDGYPRNASQVQALDRMLEELGTPLDHVVALEAERDVL 122

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+Q R +E        RSDD  +V  KR+E Y K   PL   Y   G L  +DG+ D+
Sbjct: 123 LERMQKRAVE------QGRSDDTPEVIAKRLETYEKETAPLLDIYDSRGQLVEVDGVGDI 176

Query: 181 DEV-SRSIDSL 190
            E+ +R ++SL
Sbjct: 177 KEINNRIVESL 187


>gi|262199612|ref|YP_003270821.1| adenylate kinase [Haliangium ochraceum DSM 14365]
 gi|262082959|gb|ACY18928.1| adenylate kinase [Haliangium ochraceum DSM 14365]
          Length = 213

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA RL+   ++P +S+GDMLRA V+  T LGKQ  G M+SG+L+ 
Sbjct: 1   MRMILVGPPGAGKGTQAKRLTHLNSIPHISSGDMLRAAVNEGTELGKQADGFMKSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI  PDC  GF+LDG+PRT  QA++L   +      +DAV+ ++V D  +
Sbjct: 61  DELVIAMVIERIGKPDCAEGFMLDGFPRTRPQAEALDLAMREAGTELDAVVLIKVPDELI 120

Query: 121 FKRIQVRVLEA----------------IASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
             R+  R  +                 IA     R DD  +    R+E Y     P+  +
Sbjct: 121 VTRVTGRRTDPETGDIYHLEYQPPPAEIAERLVQRKDDTEEACRARLEKYHGETAPIVPF 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y D G L  +DG+   DEV+  +   L
Sbjct: 181 YADKGLLREVDGVGTPDEVTTRLQKAL 207


>gi|307328051|ref|ZP_07607232.1| adenylate kinase [Streptomyces violaceusniger Tu 4113]
 gi|306886356|gb|EFN17361.1| adenylate kinase [Streptomyces violaceusniger Tu 4113]
          Length = 218

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 116/207 (56%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++KL++P +STGD+ RA + + T LGKQ +  M +G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAEKLSIPHISTGDLFRANISQGTPLGKQAQEYMRAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  SGF+LDG+PR + QA++L A+++    ++DAV++L V ++ +
Sbjct: 61  DEVTIAMAEDRLDQPDAQSGFLLDGFPRNLVQAEALDAYLAERGVSLDAVLDLEVPESEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  D   KR+E Y +  
Sbjct: 121 IKRIAGRRTCRNDSSHTFHVEYKPPKVPGVCDVCGGELYQREDDSEDTVRKRLEVYHRET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I  +  + EV++
Sbjct: 181 EPIIDYYKAKGLVVTISALGKVSEVTQ 207


>gi|242025536|ref|XP_002433180.1| adenylate kinase isoenzyme 2, putative [Pediculus humanus corporis]
 gi|212518721|gb|EEB20442.1| adenylate kinase isoenzyme 2, putative [Pediculus humanus corporis]
          Length = 238

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 114/209 (54%), Gaps = 21/209 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LGK++K +M+ G L+SD +
Sbjct: 16  ILLGPPGSGKGTQAPLLVKKFCVCHLSTGDMLRAEIATGSSLGKELKKTMDEGKLVSDEL 75

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V +++   +  P+C +G++LDG+PRTV QA+ L A +      +DAVIE  + D S+ +R
Sbjct: 76  VVELIDTNMDKPECKNGWLLDGFPRTVPQAEKLDALLEKKKKNLDAVIEFSIPDDSLVRR 135

Query: 124 IQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++                      +  E  V RSDD  D   KR+E Y K   PL 
Sbjct: 136 ITGRLIHPPSGRSYHEEFHPPLVAMKDDLTGEPLVKRSDDNVDALKKRLEAYHKQTKPLV 195

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            YY   G  Y +D      +V   IDS+ 
Sbjct: 196 DYYTIKGVHYKVDASKPAGDVFSEIDSIF 224


>gi|297545309|ref|YP_003677611.1| adenylate kinase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|296843084|gb|ADH61600.1| adenylate kinase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 217

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MKIILLGPPGAGKGTQAKKIAKEFDIPHISTGDIFRQNLRENTDLGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V +R+   DC  GF+LDGYPR V+QA+ L  F+      +D V+ + VE  ++
Sbjct: 61  DEVTNKIVENRLEKNDCQKGFLLDGYPRNVEQAEELDRFLQGKGIHLDCVLNIEVEKEAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +   ++   RSDDK +  +KR+E Y     
Sbjct: 121 IERITGRRVCPNCGATYHIKTFPPTVDNVCDKCGAQLIQRSDDKLESVVKRLEVYESQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y   G L  IDG   ++EV   I  +L
Sbjct: 181 PLIEHYTKKGILVNIDGNKSVEEVFEDIKKVL 212


>gi|283782775|ref|YP_003373529.1| adenylate kinase [Gardnerella vaginalis 409-05]
 gi|283441469|gb|ADB13935.1| adenylate kinase [Gardnerella vaginalis 409-05]
          Length = 186

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 111/191 (58%), Gaps = 7/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +  +T LGKQV+G ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNLKNHTELGKQVQGYLDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  SG+ILDGYPR   Q ++L   +  +   +D V+ L  E   +
Sbjct: 61  DELTNSIVKDRLAQDDAKSGWILDGYPRNASQVQALDRMLEELGTPLDHVVALEAERDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+Q R +E        RSDD  +V  KR+E Y K   PL   Y   G L  +DG+ D+
Sbjct: 121 LERMQKRAVE------QGRSDDTPEVIAKRLETYEKETAPLLDIYDSRGQLVEVDGVGDI 174

Query: 181 DEV-SRSIDSL 190
            E+ +R ++SL
Sbjct: 175 KEINNRIVESL 185


>gi|222056684|ref|YP_002539046.1| Adenylate kinase [Geobacter sp. FRC-32]
 gi|254806991|sp|B9M6F7|KAD_GEOSF RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|221565973|gb|ACM21945.1| Adenylate kinase [Geobacter sp. FRC-32]
          Length = 214

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 122/212 (57%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA  L +K  +PQ+STGD+LRA V   T +G + K  M++G+L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAKLLIKKYRIPQISTGDILRAAVKDMTPMGGKAKSFMDAGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ +R+ L DC +GFILDG+PRTV QA +L   +S +  +ID VI + V++  +
Sbjct: 61  DEVVVGIIQERLNLADCSNGFILDGFPRTVAQADALAKVLSGLGRSIDHVISIVVDNEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +  + E   R DD+ D   KR+E Y +   
Sbjct: 121 LERVTGRRTCRNCGKGFHVSFDPPKSSGICDECSGELYQRDDDREDTMRKRLEVYWQQTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++   L  ++G+  M+E+ + I S+L
Sbjct: 181 PLVEYYKNKSLLRSVEGVGSMEEIQQKIVSIL 212


>gi|289620205|emb|CBI53063.1| unnamed protein product [Sordaria macrospora]
          Length = 278

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 122/223 (54%), Gaps = 22/223 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K N   L+TGDMLRA+V + T LGKQ K  M  G L+S
Sbjct: 41  VRMILIGPPGAGKGTQAPKIKEKFNCCHLATGDMLRAQVAKGTALGKQAKKIMNEGGLVS 100

Query: 61  DAIVNQVVCDRIR-LPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ D +    +C  GFILDG+PRTV QA+ L A +   +  +   +EL+++D+ 
Sbjct: 101 DDIVIGMIKDELENNKECQGGFILDGFPRTVPQAEGLDAMLRERNLPLQHAVELKIDDSL 160

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  +   KR+E Y K  
Sbjct: 161 LVARITGRLVHPASGRSYHLTFNPPKEAMKDDITGEPLVQRSDDNAEALRKRLETYHKQT 220

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
            P+  YY++ G    ID   +  +V +S+ ++    + K S++
Sbjct: 221 APVVGYYQNTGIWKAIDASQEPGQVWKSLLAIFDGDKAKASNA 263


>gi|306840322|ref|ZP_07473094.1| adenylate kinase [Brucella sp. BO2]
 gi|306289721|gb|EFM60910.1| adenylate kinase [Brucella sp. BO2]
          Length = 143

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 97/140 (69%)

Query: 53  MESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIE 112
           M++G L+SD IVNQ+V +RI  PDC +GFILDGYPRTV QA++L   +S     +DAVIE
Sbjct: 2   MDAGQLVSDEIVNQIVSERIDAPDCANGFILDGYPRTVPQAQALSQMLSGKGLKLDAVIE 61

Query: 113 LRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLY 172
           L+V++ ++ KR++ RV E IA    VRSDD  + F KR+  YR+   PLSSYY   G L 
Sbjct: 62  LKVDENALVKRMESRVAETIAKGGQVRSDDNPEAFRKRLVEYREKTAPLSSYYAGTGELR 121

Query: 173 IIDGMLDMDEVSRSIDSLLV 192
           +I+GM  ++EV+  I+ +LV
Sbjct: 122 VINGMAPVEEVTAEIERILV 141


>gi|160941049|ref|ZP_02088387.1| hypothetical protein CLOBOL_05942 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435998|gb|EDP13765.1| hypothetical protein CLOBOL_05942 [Clostridium bolteae ATCC
           BAA-613]
          Length = 214

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LG + K  M++G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYQIPHISTGDIFRANIKNGTELGMKAKSYMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   ++ DRI   DC +G++LDG+PRT+ QA+SL   + +M  AID  I + V D ++
Sbjct: 61  DEITIGMLLDRIHEEDCKNGYVLDGFPRTIPQAESLTKALGDMGEAIDYAINVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    +  +R DDK +   KR++ Y     
Sbjct: 121 INRMSGRRACLSCGATYHIVYNPPKKEGICDVCGQQLVLRDDDKPETVKKRLDVYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  +DG LDM+EV ++I  +L
Sbjct: 181 PLIEYYKKAGVLAEVDGTLDMEEVFQAIVRIL 212


>gi|326390641|ref|ZP_08212196.1| adenylate kinase [Thermoanaerobacter ethanolicus JW 200]
 gi|325993319|gb|EGD51756.1| adenylate kinase [Thermoanaerobacter ethanolicus JW 200]
          Length = 217

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAVKIAKEFDIPHISTGDIFRQNLRDNTDLGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR V QA+ L  F+      +D V+ + VE+ ++
Sbjct: 61  DEVTNKIVEDRLEKDDCQKGFLLDGYPRNVTQAEELDRFLQQKGTYLDCVLNIEVEEDAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +  +++   RSDDK +  +KR+E Y     
Sbjct: 121 IERITGRRVCPNCGATYHIKTSPPAVDNVCDKCSTKLIQRSDDKLESVVKRLEVYESQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  IDG   ++EV   I   L
Sbjct: 181 PLIEYYTKKNILVNIDGNKSVEEVFEDIKKAL 212


>gi|323144026|ref|ZP_08078674.1| adenylate kinase [Succinatimonas hippei YIT 12066]
 gi|322416202|gb|EFY06888.1| adenylate kinase [Succinatimonas hippei YIT 12066]
          Length = 215

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 113/192 (58%), Gaps = 27/192 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  ++++ ++PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 1   MRIILLGPPGAGKGTQAQTITKEFSIPQISTGDMLRAAIKEGTELGKQAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI   DC +GF+ DG+PRT+ QA++L     + D  IDAV+EL+V D  +
Sbjct: 61  DDIILGLVKERIAKEDCKNGFLFDGFPRTIPQAQAL----VDADITIDAVVELQVPDEKI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            KR+  R +  +AS ++                      +R DD+      R+E Y K  
Sbjct: 117 VKRMSGRRVH-LASGRTYHIVYNPPKVEGKDDVTGEDLVIRPDDEESTVRSRLEVYHKQT 175

Query: 159 LPLSSYYRDMGC 170
            PL  +Y+D+  
Sbjct: 176 EPLVDFYKDLAA 187


>gi|295688927|ref|YP_003592620.1| adenylate kinase [Caulobacter segnis ATCC 21756]
 gi|295430830|gb|ADG10002.1| adenylate kinase [Caulobacter segnis ATCC 21756]
          Length = 189

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 116/191 (60%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL  +  + QLSTGDMLRA +   + LG++VKG ++ G L++
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVSERGMVQLSTGDMLRAAIASGSELGQRVKGVLDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+   +   G I DG+PRTV QA++L   +++    ID V+ L+V++ ++
Sbjct: 61  DEIVIALIEERLPEAEAAGGAIFDGFPRTVAQAEALDKILASRGQKIDVVLRLKVDEPAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ R       E+  R DD  +VF+ R+  Y     PL  YY+  G L  +DGM  +
Sbjct: 121 IERIKKRF------EEQGRPDDNPEVFVTRLAAYNAQTAPLLPYYQGQGKLKELDGMGSV 174

Query: 181 DEVSRSIDSLL 191
           + V+ SID+ L
Sbjct: 175 EAVATSIDAAL 185


>gi|91076036|ref|XP_972103.1| PREDICTED: similar to Adenylate kinase-2 CG3140-PA [Tribolium
           castaneum]
 gi|270014676|gb|EFA11124.1| hypothetical protein TcasGA2_TC004724 [Tribolium castaneum]
          Length = 239

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 119/214 (55%), Gaps = 21/214 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA +L +K  V  LSTGDMLRAE+   ++LG ++K  M+ G L+SD +
Sbjct: 21  ILLGPPGSGKGTQAPKLKEKYCVCHLSTGDMLRAEIQSGSVLGAKLKKIMDEGKLVSDDL 80

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +   D ++DAVIE  ++D+ + +R
Sbjct: 81  VVNMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDDLLEKRDTSLDAVIEFGIDDSLLVRR 140

Query: 124 IQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++                      +  E  V RSDD  +   KR++ Y     PL 
Sbjct: 141 ITGRLIHPKSGRSYHEEFHPPRKPMTDDVTGEPLVRRSDDTAEALKKRLQAYHTQTRPLV 200

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            YY+  G  + ID     +EV   IDS+ +  RK
Sbjct: 201 DYYQIRGIHHRIDASKAANEVFSKIDSIFMRARK 234


>gi|73667638|ref|YP_303653.1| adenylate kinase [Methanosarcina barkeri str. Fusaro]
 gi|121723657|sp|Q46GB9|KAD_METBF RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|72394800|gb|AAZ69073.1| Adenylate kinase [Methanosarcina barkeri str. Fusaro]
          Length = 215

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  GPPG+GKGTQA ++     +PQ+STGD+LRA V   T LG   K  M+ G L+ 
Sbjct: 1   MNIILFGPPGAGKGTQAKKMVDNYGIPQISTGDILRANVREGTELGLAAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +R++  DC+ GFILDGYPRT+ QA +L   +  ++  ID V+ L V D  +
Sbjct: 61  DEVLIGIIKNRLKEQDCEKGFILDGYPRTIPQADALAVILDEINKPIDVVLNLEVPDEEL 120

Query: 121 FKRIQVRVL--------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
            +RI  R++                    +    +   R+DDK +    R+  Y+K   P
Sbjct: 121 IERISGRLMCNCGASYHRTFNPPKKDDVCDICGGKVFQRADDKEEAVKNRLNVYKKQTEP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY   G L  +DG  D+DEV   I ++L
Sbjct: 181 LIDYYTKQGLLVTLDGTKDIDEVFEEIKAVL 211


>gi|157133422|ref|XP_001662844.1| adenylate kinase 1, putative [Aedes aegypti]
 gi|121959090|sp|Q1HQK0|KAD2_AEDAE RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|94469256|gb|ABF18477.1| adenylate kinase [Aedes aegypti]
 gi|108870854|gb|EAT35079.1| adenylate kinase 1, putative [Aedes aegypti]
          Length = 241

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 115/214 (53%), Gaps = 21/214 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG Q+K  M+ G L+SD +
Sbjct: 23  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIAAGSKLGAQLKKVMDEGKLVSDDL 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAV+E  ++D+ + +R
Sbjct: 83  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDDLLEKRKTGLDAVVEFGIDDSLLVRR 142

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD     +KR+E Y K   PL+
Sbjct: 143 ITGRLIHQASGRSYHEEFAPPKVAMTDDVTGEPLMRRSDDNAAALVKRLEAYHKQTKPLA 202

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            YY   G  + +D       V  +IDS+  S RK
Sbjct: 203 DYYALRGLHFRVDAAQSASRVFENIDSIFTSQRK 236


>gi|300112957|ref|YP_003759532.1| adenylate kinase [Nitrosococcus watsonii C-113]
 gi|299538894|gb|ADJ27211.1| adenylate kinase [Nitrosococcus watsonii C-113]
          Length = 217

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 118/217 (54%), Gaps = 22/217 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR + LG PGSGKGTQ   LSQ+ N+PQ+STGD+LRA V     LGKQ K +ME+G L+S
Sbjct: 1   MRTVLLGAPGSGKGTQGEHLSQQYNIPQISTGDLLRAAVTAGNELGKQAKAAMEAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+  PD   G+ILDG+PR   QA++L   ++ ++  + AVI L VE   +
Sbjct: 61  DQIVIGIIRERLTQPDAAKGYILDGFPRNFAQAQALDEVLAVLEQPLQAVILLDVEFEVL 120

Query: 121 FKRIQVR--------VLEAIASEKSV--------------RSDDKYDVFLKRIENYRKTI 158
            KR+  R        +     S   V              RSDD  +    R+  Y    
Sbjct: 121 MKRLTGRRTCQACGAIYNIYFSPPQVDQRCDKCSSDQLVQRSDDNEETISNRLRVYEAQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            PL  YY   G LY ++G  D+ +++++I  +L +V+
Sbjct: 181 APLVDYYEAQGKLYRVNGADDITKIAKNIGKILETVK 217


>gi|255282626|ref|ZP_05347181.1| adenylate kinase [Bryantella formatexigens DSM 14469]
 gi|255266919|gb|EET60124.1| adenylate kinase [Bryantella formatexigens DSM 14469]
          Length = 214

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+ LG PG+GKGTQA R+++K  +P +STGD+LRA V   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIVMLGAPGAGKGTQAKRIAEKYEIPHVSTGDILRANVKGATELGKKAKEFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PDC  G+ILDG+PRT+ QA+SL A +      +D  I++ V D ++
Sbjct: 61  DELVIDMLMDRIAQPDCTKGYILDGFPRTIPQAESLDAALEKQGDKLDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +    +  +R DDK +   KR++ Y     
Sbjct: 121 VKRMGGRRACLGCGATYHVVFNPTKEEGVCDVCGEKLILRDDDKPETVQKRLDVYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y++ G L  +DG ++MD V   I  +L
Sbjct: 181 PLIDFYKNAGILKTVDGTMEMDRVFEEIVQIL 212


>gi|307266994|ref|ZP_07548510.1| adenylate kinase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917979|gb|EFN48237.1| adenylate kinase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 217

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAVKIAKEFDIPHISTGDIFRQNLRDNTDLGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR V QA+ L  F+      +D V+ ++VE  ++
Sbjct: 61  DEVTNKIVEDRLEKDDCQKGFLLDGYPRNVTQAEELDRFLQQKGTYLDCVLNIKVEKDAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +  +++   RSDDK +  +KR+E Y     
Sbjct: 121 IERITGRRVCPNCGATYHIKTSPPAVDNVCDKCSTKLIQRSDDKLESVVKRLEVYESQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  IDG   ++EV   I   L
Sbjct: 181 PLIEYYTKKNILVNIDGNKSVEEVFEDIKKAL 212


>gi|220928228|ref|YP_002505137.1| adenylate kinase [Clostridium cellulolyticum H10]
 gi|254806981|sp|B8I800|KAD_CLOCE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|219998556|gb|ACL75157.1| adenylate kinase [Clostridium cellulolyticum H10]
          Length = 214

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 116/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  +S+KLN+P +STGD+ RA +  NT LG++ K  M+ G L+ 
Sbjct: 1   MRIILLGAPGAGKGTQAKIISEKLNIPHVSTGDIFRANIKGNTPLGQKAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GFILDG+PRT+ QA+ L   +  M+  +D  + + V+D  +
Sbjct: 61  DELTVEIVKDRLGNVDCVNGFILDGFPRTIPQAEYLDKVLVQMNINLDVALLIDVKDEDI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + +   S    R+DD  +  L R+E Y K   
Sbjct: 121 IKRMSGRRVCTNCGATYNVVFNPTKVEGICDVCNSPVIQRADDAAETVLNRLETYHKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL +YY   G L + +G  ++DE S+ +
Sbjct: 181 PLINYYEKAGKLKVAEGAGEVDETSKRV 208


>gi|256785802|ref|ZP_05524233.1| adenylate kinase [Streptomyces lividans TK24]
 gi|289769694|ref|ZP_06529072.1| adenylate kinase [Streptomyces lividans TK24]
 gi|289699893|gb|EFD67322.1| adenylate kinase [Streptomyces lividans TK24]
          Length = 217

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 111/207 (53%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++ L++P +STGD+ RA + + T LGK  K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATRLAETLHIPHISTGDLFRANISQQTELGKLAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +   D  +DAV++L   +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLETEDMKLDAVLDLEAPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRVCRNDSAHVFHVTYTPPKKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I     +DEV+R
Sbjct: 181 EPIIDYYKSQGLVATIAATGPVDEVTR 207


>gi|99081331|ref|YP_613485.1| adenylate kinase [Ruegeria sp. TM1040]
 gi|99037611|gb|ABF64223.1| Adenylate kinase [Ruegeria sp. TM1040]
          Length = 227

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 117/214 (54%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  GKQ K  M++G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARMLQEKYGLVQLSTGDLLRAAVAAGTDAGKQAKAVMDAGGLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC +G ILDG+PRT  QAK+L   +++    I+A I L V D++M  
Sbjct: 72  IVIAILKDRMNDADCRNGVILDGFPRTTVQAKALDGLLASTGQRINAAISLEVNDSAMVT 131

Query: 123 RIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A   E                       + R+DD+ +    R+E Y     P
Sbjct: 132 RISGRSTCADCGEGYHDTFKPPMPGEVCAKCGGETLTRRADDRAETVASRLEAYHAQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY++ G L  +D M ++  V+  I S++ ++
Sbjct: 192 LIAYYQEAGVLKSVDAMAEISSVATQISSVVETI 225


>gi|169630863|ref|YP_001704512.1| adenylate kinase [Mycobacterium abscessus ATCC 19977]
 gi|238688914|sp|B1MGB3|KAD_MYCA9 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|169242830|emb|CAM63858.1| Adenylate kinase [Mycobacterium abscessus]
          Length = 181

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 108/183 (59%), Gaps = 12/183 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  +S+K  +PQ+STGD+ R+ +   T LG Q K  +++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQLISEKFGIPQISTGDLFRSNISEGTELGLQAKQYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N++V  R+  PD  +GFILDG+PRTVDQA +L A        IDAV+E RV    +
Sbjct: 61  SEVTNKMVEARLDEPDAAAGFILDGFPRTVDQADALAAMEEARGVTIDAVLEFRVPVEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  D+   R+  YR    PL  YY+++  L  ID +  +
Sbjct: 121 VQRLLGR----------GRADDTEDIIRNRLNVYRDETAPLLEYYQNV--LQTIDAVGTV 168

Query: 181 DEV 183
           DEV
Sbjct: 169 DEV 171


>gi|21228250|ref|NP_634172.1| adenylate kinase [Methanosarcina mazei Go1]
 gi|24418466|sp|Q8PV26|KAD_METMA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|20906707|gb|AAM31844.1| Adenylate kinase [Methanosarcina mazei Go1]
          Length = 215

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 114/211 (54%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  GPPG+GKGTQA +L     +PQ+STGD+LRA V   T LG   K  M+ G L+ 
Sbjct: 1   MNIILFGPPGAGKGTQAKKLVDFYGIPQISTGDILRANVREGTELGLAAKAYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +R+   DC  GFILDGYPRTV QA +L   +  +D  ID V+ L V D  +
Sbjct: 61  DNVLIGIIKNRLNEEDCKKGFILDGYPRTVPQADALETILDEIDKPIDVVLNLEVPDEVL 120

Query: 121 FKRIQVRVL-------EAIAS-------------EKSVRSDDKYDVFLKRIENYRKTILP 160
            +RI  R++         IA+             E   R DDK +    R++ Y+K   P
Sbjct: 121 VERISGRLMCKCGASYHTIANPPKKDNICDICGGEVYQRDDDKAEAVQNRLDVYKKQTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L +YY + G L  +DG  D++ V   I ++L
Sbjct: 181 LINYYEEKGILVTLDGTKDINVVFEDIKAVL 211


>gi|256825865|ref|YP_003149825.1| Adenylate kinase [Kytococcus sedentarius DSM 20547]
 gi|256689258|gb|ACV07060.1| Adenylate kinase [Kytococcus sedentarius DSM 20547]
          Length = 193

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 112/190 (58%), Gaps = 6/190 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+I LGPPG+GKGTQA  ++++  +P +STGD+ RA +   T LGKQVK    SG+L+ D
Sbjct: 3   RMIILGPPGAGKGTQAALIAERYGIPAISTGDIFRANIKAETELGKQVKEITASGALVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V DR+   D   GF+LDGYPR + Q ++L   +     ++D VIEL V+   + 
Sbjct: 63  ELTNRIVEDRLAQTDAQEGFLLDGYPRNLGQVEALDTMLRATGQSLDVVIELVVDTEEVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R      +E   R DD  +V   R++ Y +   PLS  Y   G L  +DG+ ++D
Sbjct: 123 QRLLKR------AEVEGREDDTEEVVRHRMDVYTEQTAPLSEAYDKRGLLERVDGLGEVD 176

Query: 182 EVSRSIDSLL 191
           EV+  I  +L
Sbjct: 177 EVTARITEVL 186


>gi|149201060|ref|ZP_01878035.1| adenylate kinase [Roseovarius sp. TM1035]
 gi|149145393|gb|EDM33419.1| adenylate kinase [Roseovarius sp. TM1035]
          Length = 228

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 115/212 (54%), Gaps = 22/212 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G+  K  ME+G L+SDA
Sbjct: 13  LVLLGPPGAGKGTQARMLEEQFGLVQLSTGDLLRAAVAAGTEAGRAAKAVMEAGDLVSDA 72

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++ +   I + I L V+DA+M  
Sbjct: 73  IVIAILRDRLAEPDCAKGVILDGFPRTTVQAEALDGLLAEIGQGIRSAISLEVDDAAMVT 132

Query: 123 RIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                        +   +E   R+DD  +   +R+  Y     P
Sbjct: 133 RISGRYTCGGCGEGYHDSFKMPNVAGICDKCGGTEMKRRADDNAETVEQRLRAYHAQTAP 192

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
           L SYY   G L  +D M +++ V+R +++++ 
Sbjct: 193 LISYYESRGVLARVDAMAEIEAVARELNAIVA 224


>gi|329114197|ref|ZP_08242959.1| Adenylate kinase [Acetobacter pomorum DM001]
 gi|326696273|gb|EGE47952.1| Adenylate kinase [Acetobacter pomorum DM001]
          Length = 222

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 122/215 (56%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M IIFLGPPG+GKGTQ+  L ++  + Q+STGDMLRAEV + +  GKQ K  M++G L+ 
Sbjct: 1   MNIIFLGPPGAGKGTQSKLLEERYGLIQISTGDMLRAEVAKGSETGKQAKALMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RI   DC +GFILDG+PRT+ QA+ L   +S+    ID V+ L V++  +
Sbjct: 61  DELIIAMLKSRIAQADCQNGFILDGFPRTLAQAEELDGMLSSDGKKIDTVLFLDVDEEIL 120

Query: 121 FKRIQVR---------------------VLEAIAS-EKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                     V ++  S E   R+DDK +  ++R++ YRK  
Sbjct: 121 ADRISGRFTCGNCGKTYNEVSNPPKVDGVCDSCGSHEFKRRADDKRETVVERLKEYRKLT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+  +Y   G L+ I+GML   EV+  I+  L S
Sbjct: 181 APILPFYEKTGRLHKINGMLSAPEVTGEIEDALAS 215


>gi|17552384|ref|NP_498730.1| LEThal family member (let-754) [Caenorhabditis elegans]
 gi|20981697|sp|P34346|KAD2_CAEEL RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2; AltName:
           Full=Lethal protein 754
 gi|15617712|gb|AAA27957.3| Lethal protein 754, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 251

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 115/219 (52%), Gaps = 23/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R IF+GPPGSGKGTQA   +QK     L+TGD+LRAEV   +  GK++K +M++G L+S
Sbjct: 27  IRAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVS 86

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++  ++  P+C  GFILDG+PRT  QA+ L   +      +D V+E  + D  +
Sbjct: 87  DEVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLL 146

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +RI  R+   IAS +S                       RSDD  +   KR+  Y +  
Sbjct: 147 VRRITGRLFH-IASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMT 205

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           +PL  YY+  G    +D    M +V   ID +     +K
Sbjct: 206 VPLVDYYKKHGVHVAVDAAKPMTDVKAHIDQVFAKFTQK 244


>gi|332179523|gb|AEE15212.1| Adenylate kinase [Thermodesulfobium narugense DSM 14796]
          Length = 216

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 117/208 (56%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++FLG PG+GKGTQA  L ++L +PQ+STGDMLR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLVFLGAPGAGKGTQAKMLVEQLKIPQISTGDMLRKAVADGTPLGKEAKSYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++V  ++ +R++ PD ++GFILDG+PR V QAK L + + ++   +D  + L V    +
Sbjct: 61  DSVVIGLIKERLQEPDTENGFILDGFPRNVSQAKELDSLLGDLGKPLDVALVLDVPFEDL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                       +    E   R+DD  +   KR+E Y+ +  
Sbjct: 121 MKRLTGRRTCKSCGQMYNIYFSPPKVEGKCDVCGGELYQRADDNEETIKKRLEVYQSSTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR+ G L +++G  D++ + R I
Sbjct: 181 PLIEYYRNKGILKVVEGTGDINAIYRKI 208


>gi|126729416|ref|ZP_01745230.1| adenylate kinase [Sagittula stellata E-37]
 gi|126710406|gb|EBA09458.1| adenylate kinase [Sagittula stellata E-37]
          Length = 228

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 115/211 (54%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++    QLSTGD+LRA V   T  G++ K  ME+G L+SD 
Sbjct: 13  LILLGPPGAGKGTQARMLEERFGFVQLSTGDLLRAAVAAGTDAGRRAKAVMEAGELVSDE 72

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC  G ILDG+PRT  QA++L   +      IDA I L VEDA+M  
Sbjct: 73  IVIAILRDRMAQSDCAQGVILDGFPRTAVQAEALDTLLQETGQKIDAAISLEVEDAAMVT 132

Query: 123 RIQVRVL---------------EAI-------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                 +A+        +E   R+DD  +    R+E Y     P
Sbjct: 133 RISGRFTCGGCGEGYHDSFKQPQAMGTCDKCGGTEFKRRADDNAETVASRLEAYHAQTAP 192

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L +YY+  G L  I+ M ++D+++R + +++
Sbjct: 193 LIAYYKAQGALIGINAMGEIDDIARKMTAIV 223


>gi|302558973|ref|ZP_07311315.1| adenylate kinase [Streptomyces griseoflavus Tu4000]
 gi|302476591|gb|EFL39684.1| adenylate kinase [Streptomyces griseoflavus Tu4000]
          Length = 217

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 114/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++KL +P +STGD+ RA + R T LGK  K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATRLAEKLRIPHISTGDLFRANISRQTELGKLAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +      +DAV++L   +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLQTEGIKLDAVLDLEAPEDEV 120

Query: 121 FKRI----------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI                      Q  V +    E   R DD       R+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHATYSPPKQAGVCDTCGGELYQRDDDSESTVRTRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G +  I  M  +DEV+ R++++L
Sbjct: 181 EPIIDYYKAQGLVVTISAMGAVDEVTGRALEAL 213


>gi|313904931|ref|ZP_07838302.1| adenylate kinase [Eubacterium cellulosolvens 6]
 gi|313470188|gb|EFR65519.1| adenylate kinase [Eubacterium cellulosolvens 6]
          Length = 213

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K N+P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYNIPHISTGDIFRANIKNGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PD  +G++LDG+PRT+ QA++L   +     AID  I++ V D ++
Sbjct: 61  DELTCDLVVDRISQPDAANGYVLDGFPRTIPQAEALTNALKARGEAIDYAIDVTVPDDNI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +   S+  +R DDK +   KR++ Y     
Sbjct: 121 INRMSGRRACVNCGATYHLVYNAPAKEGVCDTCGSDLILRDDDKPETVQKRLDVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY + G L+ +DG  D+D+V   I + L
Sbjct: 181 PLIDYYTEAGVLFAVDGTQDIDKVFDDITAKL 212


>gi|78777286|ref|YP_393601.1| adenylate kinase [Sulfurimonas denitrificans DSM 1251]
 gi|78497826|gb|ABB44366.1| Adenylate kinase [Sulfurimonas denitrificans DSM 1251]
          Length = 215

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 124/218 (56%), Gaps = 31/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L+++ N+PQ+STGDMLRA +   T +GK  K +M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAGFLTKRYNIPQISTGDMLRAAIKAGTEMGKMAKEAMDTGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DRI   DC +GF+LDG+PRT+ QA +    ++N    IDAVIE+ V D+ +
Sbjct: 61  DEIIIGLVKDRIEEEDCKNGFLLDGFPRTLAQADA----VTNAGINIDAVIEIDVPDSEI 116

Query: 121 FKRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+                    +V   + I  E+ V R DDK  V L R+  Y +   
Sbjct: 117 VKRMSGRRAHLASGRTYHLVYNPPKVEGKDDITGEELVQRDDDKESVVLDRLRVYHEQTS 176

Query: 160 PLSSYYRDMGC-----LYI-IDGMLDMDEVSRSIDSLL 191
           PL  YY++         YI +DG  D+ +V  +I S L
Sbjct: 177 PLIGYYKNQATKLDTLTYITVDGTADIADVEAAIVSKL 214


>gi|162149153|ref|YP_001603614.1| adenylate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545103|ref|YP_002277332.1| adenylate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|189046019|sp|A9H3J9|KAD_GLUDA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|161787730|emb|CAP57326.1| Adenylate kinase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532780|gb|ACI52717.1| Adenylate kinase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 219

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 118/219 (53%), Gaps = 22/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLGPPG+GKGTQ+ RL  +  + Q+STGDMLRAEV   + +GKQ +  M++G L+ 
Sbjct: 1   MNVIFLGPPGAGKGTQSKRLEARYGIAQISTGDMLRAEVAAESAIGKQARALMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RI  PDC  GFILDG+PRT  QA +L + +      ID V+ L V++ ++
Sbjct: 61  DDVIVAMLESRIAQPDCAKGFILDGFPRTQGQAVALDSMLKRRGARIDVVLFLEVDEEAL 120

Query: 121 FKRIQVRVLEA--------------------IASEKSV--RSDDKYDVFLKRIENYRKTI 158
             RI  R   A                    +    S   R DD+ +    R+  YRK  
Sbjct: 121 ADRIAGRFTCATCGAGYNDLFKKPKVEGTCDVCGGHSFVRREDDRRETVAARLVAYRKQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
            P+  YY   G L  IDGM D+D V+  +  ++ ++ KK
Sbjct: 181 APILPYYEAEGLLRRIDGMADIDTVTAKVFEIMDAITKK 219


>gi|319788220|ref|YP_004147695.1| adenylate kinase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466732|gb|ADV28464.1| adenylate kinase [Pseudoxanthomonas suwonensis 11-1]
          Length = 188

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 111/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL + L VP +STGD+LRAEV   + LG Q K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKETLGVPHISTGDLLRAEVAAGSPLGLQAKEVMARGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR + QA +L   ++ +   +DAV++L V    +
Sbjct: 61  DDILLGMLESRLGRDDVAKGFILDGYPRNLAQADALDGLLAKIGQPLDAVVQLDVATDLL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R+DD  +   KR++ Y  +  P+  ++ + G L  IDG+  M
Sbjct: 121 VERIAGR------AQAEGRADDNPESVRKRLQVYNDSTAPVIGFFENRGTLTRIDGVGTM 174

Query: 181 DEVSRSI 187
           DE++  I
Sbjct: 175 DEITARI 181


>gi|331004142|ref|ZP_08327622.1| adenylate kinase [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411552|gb|EGG90962.1| adenylate kinase [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 213

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K ++P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAKKYDIPHISTGDIFRANIKEKTELGNKAKEYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   ++ DRI   DC +GF+LDG+PRT+ QA+SL   +S +   ID  + + V D S+
Sbjct: 61  DDITIGMLLDRIHKDDCKNGFVLDGFPRTIPQAQSLTKALSELGEKIDYAVNIDVPDESI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +   +E  +R DDK +   KR+E Y     
Sbjct: 121 ITRMSGRRACLSCGATYHIVYSAPKAKDVCDTCGNELVIRDDDKPETVKKRLEIYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++   L  +DG  DM+EV   I S+L
Sbjct: 181 PLIDYYKNEKILASVDGTKDMEEVFIDIISVL 212


>gi|240848861|ref|NP_001155593.1| adenylate kinase 2, mitochondrial [Acyrthosiphon pisum]
 gi|239788716|dbj|BAH71026.1| ACYPI004945 [Acyrthosiphon pisum]
          Length = 247

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 122/220 (55%), Gaps = 27/220 (12%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA +L QK     LSTGDMLR+EV   + LG++VK  +ESG+L+SD++
Sbjct: 24  VLLGPPGSGKGTQAPKLLQKFYSCHLSTGDMLRSEVASGSELGQKVKQVIESGNLVSDSL 83

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C  GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ + +R
Sbjct: 84  VVDLIDRNLDRPECRQGFLLDGFPRTVPQAEKLDNLLEKRKTQLDSVIEFNISDSLLVRR 143

Query: 124 IQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTILPL 161
           I  R++   AS +S                       R+DD  D   KR+E+Y K   PL
Sbjct: 144 ITGRLIHP-ASGRSYHDEFHPPKVNMTDDITGESLIRRADDNVDALKKRLESYHKQTSPL 202

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
             YY+  G    +D     DEV + ++ + +    +CSSS
Sbjct: 203 IDYYQKKGIHSKVDASKSSDEVFKMVEDIFL----RCSSS 238


>gi|322787988|gb|EFZ13829.1| hypothetical protein SINV_07627 [Solenopsis invicta]
          Length = 246

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 115/218 (52%), Gaps = 21/218 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA     +  V  LSTGDMLRAEV   + LG Q+K  M+ G L+SD +
Sbjct: 23  VLLGPPGSGKGTQAPLFKDRYCVCHLSTGDMLRAEVSSGSTLGAQIKKVMDEGKLVSDDL 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V +++ + ++ P+C  GF+LDG+PR+V QA+ L   ++     +DAVIE  +ED  + KR
Sbjct: 83  VVKMIENNLQKPECKRGFLLDGFPRSVPQAEKLDEMLNKRKTKLDAVIEFGIEDKLLIKR 142

Query: 124 IQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++                      I  E  V RSDD  +   KR+  Y     PL 
Sbjct: 143 ITGRLIHPASGRSYHEEFAPPKIPMKDDITGEPLVRRSDDNEEALKKRLATYHTQTAPLV 202

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSS 200
            YY   G  Y I+     ++V ++ID + +   KK  S
Sbjct: 203 DYYALQGIHYYINAAQSAEKVFKNIDQIFLKSTKKKES 240


>gi|301090224|ref|XP_002895337.1| adenylate kinase, putative [Phytophthora infestans T30-4]
 gi|262100473|gb|EEY58525.1| adenylate kinase, putative [Phytophthora infestans T30-4]
          Length = 423

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 113/208 (54%), Gaps = 23/208 (11%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R IF+GPPG GKGTQ+ R+  +  +  L+TGD+LRA V   T +GK+ K +MESG+L++D
Sbjct: 210 RTIFIGPPGCGKGTQSPRVKDEYCLCHLATGDILRAAVAAGTEMGKKAKAAMESGALVTD 269

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            IV  ++ D I+ PDC  GFILDG+PRTV QAK L   +S  +  +DAV+   V D  + 
Sbjct: 270 EIVVGIIKDSIKSPDCRRGFILDGFPRTVVQAKKLDEMLSEENVQVDAVVNFNVPDKVLV 329

Query: 122 KRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTIL 159
           +RI  R +   AS +S                       R DD       R+E + K   
Sbjct: 330 ERISGRRVHP-ASGRSYHVKFAPPKVEGKDDITGEPLIQRKDDNEATLGSRLEAFHKQTQ 388

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           P+  +YR  G L  ++   DMD+V+  I
Sbjct: 389 PVIDFYRKQGKLTEVNAHTDMDKVTEQI 416


>gi|126737499|ref|ZP_01753229.1| adenylate kinase [Roseobacter sp. SK209-2-6]
 gi|126720892|gb|EBA17596.1| adenylate kinase [Roseobacter sp. SK209-2-6]
          Length = 227

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 114/214 (53%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L Q+  + QLSTGD+LRA V   T  GK  K  ME+G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARVLEQEFGLVQLSTGDLLRAAVAAGTEAGKAAKAVMEAGGLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++     I+A I L V+D++M  
Sbjct: 72  IVINILRDRLTEPDCAKGVILDGFPRTTVQAEALDVLLAETGQKINAAISLEVDDSAMVT 131

Query: 123 RIQVRVLEA----------------------IASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A                        +E + R+DD  +    R+  Y +   P
Sbjct: 132 RISGRYTCAGCGEGYHDSFKQPAVEGKCDKCGGTEMTRRADDNAETVASRLAAYHEQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY     L  ID M D+ ++S+ +  ++ SV
Sbjct: 192 LIAYYDSKDALQKIDAMGDIGDISKGLAKIVTSV 225


>gi|20089966|ref|NP_616041.1| adenylate kinase [Methanosarcina acetivorans C2A]
 gi|22653802|sp|Q8TRS3|KAD_METAC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|19914928|gb|AAM04521.1| adenylate kinase [Methanosarcina acetivorans C2A]
          Length = 215

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 114/211 (54%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  GPPG+GKGTQA +L     +PQ+STGD+LRA V   T LG   K  M+ G L+ 
Sbjct: 1   MNIILFGPPGAGKGTQAKKLVDFYGIPQISTGDILRANVREGTELGLAAKAYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +R+   DC+ GFILDGYPRTV QA +L A +  ++  ID V+ L V D  +
Sbjct: 61  DQVLIGIIKNRLNEADCEKGFILDGYPRTVPQADALEAILDEIEKPIDVVLNLEVPDEVL 120

Query: 121 FKRIQVRVL--------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
             RI  R++                    +    E   R+DD  +    R++ Y+K   P
Sbjct: 121 VGRISGRLMCKCGASYHIISNPPKKDNVCDICGGEVFQRADDTAEAVQNRLDVYKKQTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L +YY++ G L  +DG  ++D V   + ++L
Sbjct: 181 LINYYKEKGILVTLDGTKEIDVVFEDLKAIL 211


>gi|269792773|ref|YP_003317677.1| adenylate kinase [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100408|gb|ACZ19395.1| adenylate kinase [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 211

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 116/211 (54%), Gaps = 21/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  + ++  +P +STGDMLR  V   T LG++ K  M+ G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAAAVKERYRIPHISTGDMLREHVKGGTELGRKAKEFMDGGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DR+   DC++GF+LDG+PRTV QA++L   +S M   +DAV+ L V D  +
Sbjct: 61  DQLIIAMMEDRLSQGDCENGFLLDGFPRTVPQAEALDELLSRMGLQLDAVVLLEVADEVV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + EA   +   R DD+ DV  +R+  Y +   
Sbjct: 121 VQRLSGRRVCRSCGAIYHVSFHPSSKGDLCEACGGDLYQRDDDREDVIRRRLSVYHEQTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSL 190
           PL +YY   G L  ++G    D V R ++ L
Sbjct: 181 PLEAYYDAKGLLRRVNGEGATDAVLRCLEGL 211


>gi|302536272|ref|ZP_07288614.1| adenylate kinase [Streptomyces sp. C]
 gi|302445167|gb|EFL16983.1| adenylate kinase [Streptomyces sp. C]
          Length = 215

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 117/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + +NT LG++ K  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLSIPHISTGDLFRANISQNTELGRRAKAFMDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +  DR+  PD   GF+LDG+PR V QA++L A +      +DA+++L VE+  +
Sbjct: 61  DEITIGMAKDRMEQPDAKGGFLLDGFPRNVAQAEALDAMLKEAGMKLDAILDLEVEEDEV 120

Query: 121 FKRIQVR---------VLEAIASEKSV-------------RSDDKYDVFLKRIENYRKTI 158
            KRI  R         V   I +   V             R DD       R+E Y    
Sbjct: 121 VKRIAGRRICRKDSAHVFHVIYAAPEVEGVCDKCGGELYQRDDDSEATVRNRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G L  I  + ++ E++ R++D+L
Sbjct: 181 EPIIDYYKAQGLLVTISALGEVHEITKRAMDAL 213


>gi|206891102|ref|YP_002249627.1| adenylate kinase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226743912|sp|B5YHP1|KAD_THEYD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|206743040|gb|ACI22097.1| adenylate kinase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 215

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++FLG PG+GKGTQA RL +K  +PQ+STGD+LRA V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLVFLGAPGAGKGTQAKRLVEKYGIPQISTGDLLRAAVAAGTPLGKEAKAYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DC  GFILDG+PR V QA++L   +S M+  +D  + L V    +
Sbjct: 61  DKVVLGMVKERLSQNDCKKGFILDGFPRNVAQAEALDKMLSEMNMPLDLALNLDVPFDDL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                       +    E   R DDK +   KR+E YR    
Sbjct: 121 MKRLTGRRTCKSCGQMYNVYYSPSKVEGKCDKCGGELFQRDDDKEETIRKRLEVYRAQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  + G   +DE+  SI ++L
Sbjct: 181 PLIDYYSKKGILKSVSGTGSIDEIFNSICAIL 212


>gi|326203875|ref|ZP_08193737.1| adenylate kinase [Clostridium papyrosolvens DSM 2782]
 gi|325985973|gb|EGD46807.1| adenylate kinase [Clostridium papyrosolvens DSM 2782]
          Length = 214

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  +S+KL++P +STGD+ RA +  NT LG + K  M+ G L+ 
Sbjct: 1   MRIILLGAPGAGKGTQAKIISEKLSIPHISTGDIFRANIKGNTPLGLKAKAFMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GFILDG+PRT+ QA+ L   +  M+  +D  + + V+D  +
Sbjct: 61  DELTVEIVKDRLGNADCANGFILDGFPRTIPQAEYLDKVLLQMNINLDVALLINVKDEDI 120

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
            +R+  R           V+     E+ +          R+DD  +  L R+E Y K   
Sbjct: 121 IERMSGRRVCTNCGATYNVVFNPTKEEGICDVCKSAVIQRADDAAETVLNRLETYHKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY   G L + +G  +++E SR +  +L
Sbjct: 181 PLINYYEKAGKLKVAEGAGEVEETSRRVMKVL 212


>gi|167036821|ref|YP_001664399.1| adenylate kinase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039540|ref|YP_001662525.1| adenylate kinase [Thermoanaerobacter sp. X514]
 gi|256752652|ref|ZP_05493504.1| adenylate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915209|ref|ZP_07132524.1| adenylate kinase [Thermoanaerobacter sp. X561]
 gi|307725133|ref|YP_003904884.1| adenylate kinase [Thermoanaerobacter sp. X513]
 gi|320115243|ref|YP_004185402.1| adenylate kinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687619|sp|B0K5R3|KAD_THEPX RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238687716|sp|B0KCM0|KAD_THEP3 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166853780|gb|ABY92189.1| Nucleoside-triphosphate--adenylate kinase [Thermoanaerobacter sp.
           X514]
 gi|166855655|gb|ABY94063.1| Nucleoside-triphosphate--adenylate kinase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748472|gb|EEU61524.1| adenylate kinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888933|gb|EFK84080.1| adenylate kinase [Thermoanaerobacter sp. X561]
 gi|307582194|gb|ADN55593.1| adenylate kinase [Thermoanaerobacter sp. X513]
 gi|319928334|gb|ADV79019.1| adenylate kinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 217

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 114/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA +++++ ++P +STGD+ R  +  NT LGK  K  M+ G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAVKIAKEFDIPHISTGDIFRQNLRDNTDLGKLAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR V QA+ L  F+ +    +D V+ + V+  ++
Sbjct: 61  DEVTNKIVEDRLEKDDCQKGFLLDGYPRNVAQAEELDRFLHDKGIHLDCVLNIEVDREAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +   ++   RSDDK +  +KR+E Y     
Sbjct: 121 IERITGRRVCPNCGATYHIKTSPPAVDNVCDKCGAQLIQRSDDKLESVVKRLEVYESQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  IDG   ++EV   I   L
Sbjct: 181 PLIEYYTKKNTLVNIDGNKSVEEVFEDIKKAL 212


>gi|229821602|ref|YP_002883128.1| adenylate kinase [Beutenbergia cavernae DSM 12333]
 gi|229567515|gb|ACQ81366.1| adenylate kinase [Beutenbergia cavernae DSM 12333]
          Length = 192

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 107/190 (56%), Gaps = 6/190 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R + +GP GSGKGTQA RLS +L VP +STGD+ R+ V   T LG+  K  M++G L+ D
Sbjct: 4   RYVIMGPQGSGKGTQAARLSGRLGVPAISTGDIFRSNVAEGTELGRTAKAIMDAGDLVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            I N +V DR+   D  +GFILDGYPR   Q + L   ++  D A+DAVIEL  +   + 
Sbjct: 64  EITNAMVRDRLARDDARAGFILDGYPRNAAQVEELDRILAEHDEALDAVIELVADREELL 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      +E   R DD  +   +R+E Y +   PL+  Y   G L  +DG+ ++D
Sbjct: 124 ARLARR------AELEGRDDDTEEAIRRRLEVYAEQTAPLAEAYAARGLLVRVDGVGEVD 177

Query: 182 EVSRSIDSLL 191
            ++  +   L
Sbjct: 178 AITEQVAGAL 187


>gi|260907124|ref|ZP_05915446.1| adenylate kinase [Brevibacterium linens BL2]
          Length = 188

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 111/194 (57%), Gaps = 9/194 (4%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           RII +GPPG+GKGTQA RLS+ LNVP +STGD+ RA V   T LG   K  M++G  + D
Sbjct: 4   RIILIGPPGAGKGTQAARLSEALNVPAISTGDIFRANVKGETELGNLAKRYMDAGEYVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N +V DR+   D   GF+LDGYPRT  Q   L   ++     I+ V+EL  +   + 
Sbjct: 64  EVTNSMVADRLGQHDAAEGFLLDGYPRTSAQVDELDRILAAEGHEIEQVVELTADVDEVV 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      ++   RSDD  DV   R++ Y +   PL+  YR+ G L  +DG+ ++ 
Sbjct: 124 ARLLAR------AQTEGRSDDSEDVIRHRLDVYAEQTQPLTDIYRERGLLRQVDGLGEVA 177

Query: 182 EVSRSIDSLLVSVR 195
           E++   D +L S+R
Sbjct: 178 EIT---DRILDSIR 188


>gi|19114597|ref|NP_593685.1| adenylate kinase Adk1 [Schizosaccharomyces pombe 972h-]
 gi|417203|sp|P33075|KAD1_SCHPO RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|5536|emb|CAA49826.1| adenylate kinase [Schizosaccharomyces pombe]
 gi|1204204|emb|CAA93553.1| adenylate kinase Adk1 [Schizosaccharomyces pombe]
          Length = 220

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 118/213 (55%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA  + +K  +  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 4   MRLILVGPPGAGKGTQAPNIQKKYGIAHLATGDMLRSQVARQTELGKEAKKIMDQGGLVS 63

Query: 61  DAIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ D I   P+C +GFILDG+PRTV QA+ L A +  +   ++ V+EL+V+D  
Sbjct: 64  DDIVTGMIKDEILNNPECKNGFILDGFPRTVVQAEKLTALLDELKLDLNTVLELQVDDEL 123

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           + +RI  R++                      +  E  + RSDD  D   KR+  Y +  
Sbjct: 124 LVRRITGRLVHPGSGRSYHLEFNPPKVPMKDDVTGEPLIQRSDDNADALRKRLVTYHEQT 183

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+  +Y+  G    +D     ++V   I ++L
Sbjct: 184 TPVVEFYKKKGKWAAVDAAQKPEQVWEQIVAIL 216


>gi|326330293|ref|ZP_08196603.1| adenylate kinase (ATP-AMP transphosphorylase) [Nocardioidaceae
           bacterium Broad-1]
 gi|325951830|gb|EGD43860.1| adenylate kinase (ATP-AMP transphosphorylase) [Nocardioidaceae
           bacterium Broad-1]
          Length = 198

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 114/201 (56%), Gaps = 6/201 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++++  VP +STGD+ RA V   T LG   +  M++G  + 
Sbjct: 1   MRLLLMGPPGAGKGTQAAVIAERFAVPAISTGDIFRANVAEQTALGVAAQAYMDAGEYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   DC  GF+LDGYPRT  Q   L   ++  D  +DAV+ L  +   +
Sbjct: 61  DELTNAMVADRLASGDCADGFLLDGYPRTPQQVAELDEILALADVGLDAVVLLEADPDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      S++  R+DD   V  +R+E Y     PL+ +Y +   L  +DG+  +
Sbjct: 121 VGRLLAR------SQEQGRADDTESVIRRRLEVYAAETGPLADHYAERDLLARVDGLGPV 174

Query: 181 DEVSRSIDSLLVSVRKKCSSS 201
            EV+  I ++L SV  + +++
Sbjct: 175 HEVTERILTVLTSVAAQRTAT 195


>gi|302524014|ref|ZP_07276356.1| adenylate kinase [Streptomyces sp. AA4]
 gi|302432909|gb|EFL04725.1| adenylate kinase [Streptomyces sp. AA4]
          Length = 181

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 118/196 (60%), Gaps = 15/196 (7%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ +GPPG+GKGTQA  LS++L +P +STGD+ RA V + T LG++ K  ++SG L+ D+
Sbjct: 1   MVLVGPPGAGKGTQAVALSEQLRIPHISTGDLFRAHVGQETPLGQEAKRYLDSGELVPDS 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N++V +R+  PD  +GF+LDG+PR   QA+ L   +S  D  +DAVI+L V +  +  
Sbjct: 61  VTNEMVRERLAEPDAKAGFLLDGFPRNTKQAEVLGEMLSEADTKLDAVIQLDVAEDVVVS 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R           RSDD  DV  +R + Y     PL  YY D+  L  +DG+ ++ E
Sbjct: 121 RLMSR----------GRSDDTEDVIRRRQQVYVSETAPLLEYYADI--LVKVDGVGEVQE 168

Query: 183 VSRSIDSLLVSVRKKC 198
           +S   D +L ++R + 
Sbjct: 169 IS---DRVLKALRDRT 181


>gi|239623368|ref|ZP_04666399.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522334|gb|EEQ62200.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 214

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 114/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LG + K  M++G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYQIPHISTGDIFRANIKNGTELGMKAKAFMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   ++ DRI   DC  G++LDG+PRT+ QA+SL   +  M  +ID  I + V D  +
Sbjct: 61  DEITIGMLLDRIHEADCQDGYVLDGFPRTIPQAESLTTALGQMGESIDYAINVDVPDEDI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E  +R DDK +   KR++ Y     
Sbjct: 121 INRMAGRRACLACGATYHIVYNPPKKEGICDVCGQELVLRDDDKPETVKKRLDVYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  +DG +DM++V ++I  +L
Sbjct: 181 PLIEYYQKAGVLAEVDGTMDMEDVFQAIAKIL 212


>gi|296454849|ref|YP_003661993.1| adenylate kinase [Bifidobacterium longum subsp. longum JDM301]
 gi|296184281|gb|ADH01163.1| adenylate kinase [Bifidobacterium longum subsp. longum JDM301]
          Length = 186

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGLEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC++G+ILDGYPR   Q  +L   ++++D  +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCNNGWILDGYPRNAAQVTALDEMLADLDTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYESRGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+S  I S L
Sbjct: 175 DEISGRIISHL 185


>gi|315497994|ref|YP_004086798.1| adenylate kinase [Asticcacaulis excentricus CB 48]
 gi|315416006|gb|ADU12647.1| adenylate kinase [Asticcacaulis excentricus CB 48]
          Length = 190

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL    N+ QLSTGDMLRA +   + LG++VK  +++G L+S
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVVAHNMVQLSTGDMLRAAIASGSELGQKVKSIIDTGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++   +   +   G I DG+PRTV QA++L A ++  D  ID V+ L+V+D ++
Sbjct: 61  DDIVIDLIKTNLPAAEAAGGAIFDGFPRTVAQAEALDAMLAERDSTIDIVVRLKVDDNAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI+ R  E        RSDD  + +  R+  Y     PL  YY   G L  +DGM  +
Sbjct: 121 VERIEKRFAE------QGRSDDNPESYKVRLAAYNAQTAPLLPYYATQGKLVEVDGMGSV 174

Query: 181 DEVSRSIDSLL 191
           +EVS  I++ L
Sbjct: 175 EEVSARIEAAL 185


>gi|260434015|ref|ZP_05787986.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417843|gb|EEX11102.1| adenylate kinase (ATP-AMP transphosphorylase) [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 227

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 112/211 (53%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  GK  K  ME+G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARMLEEKFGLVQLSTGDLLRAAVAAGTKAGKDAKAVMEAGGLVSDD 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   +S     ++A I L VEDA M  
Sbjct: 72  IVIAILRDRMAEPDCARGVILDGFPRTTVQAEALDKLLSENGQKVNAAISLDVEDAEMVT 131

Query: 123 RIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A   E                       S R+DD  +    R+  Y +   P
Sbjct: 132 RIAGRYTCANCGEGYHDQFKQPKVEGICDKCGGTAFSRRADDNAETVASRLAAYHEQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY+  G L  ++ M  ++E++R ++ ++
Sbjct: 192 LIDYYQRQGVLKRLNAMGQIEEIARGLEGIV 222


>gi|281419367|ref|ZP_06250382.1| adenylate kinase [Clostridium thermocellum JW20]
 gi|281406987|gb|EFB37250.1| adenylate kinase [Clostridium thermocellum JW20]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 115/216 (53%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  +SQK NVP +STGD+ R+ +   T LG++ K  ++ G L+ 
Sbjct: 1   MRLVLLGAPGAGKGTQAVVISQKYNVPHISTGDIFRSNIKNGTELGRKAKEYIDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GFILDG+PRT+ QA+ L   +  ++  +D  + + V D  +
Sbjct: 61  DELTVDIVKDRISQPDCKAGFILDGFPRTIYQAERLDEILKELNVELDCTLNIYVPDEEI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + ++   E   R DDK +  ++R+  Y K   
Sbjct: 121 IKRMSGRRVCSKCGMSYHIVYNQPKVENICDSCNGELIQRDDDKEETVIQRLNTYHKQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY   G L  + G   +D+ ++ + + L  V+
Sbjct: 181 PLIEYYEKKGKLLTVHGQEGVDDTTKEVLNALSGVK 216


>gi|268575714|ref|XP_002642836.1| Hypothetical protein CBG21240 [Caenorhabditis briggsae]
          Length = 247

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 115/219 (52%), Gaps = 23/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R IF+GPPGSGKGTQA   + K     L+TGD+LRAEV   +  GKQ+K +M++G L+S
Sbjct: 28  IRAIFIGPPGSGKGTQAPAFASKYFSCHLATGDLLRAEVASGSEFGKQLKATMDAGKLVS 87

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++  ++  P+C  GFILDG+PRT  QA+ L   +      +D V+E  + D  +
Sbjct: 88  DDVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLL 147

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +RI  R+   IAS +S                       RSDD  +   KR+  Y +  
Sbjct: 148 VRRITGRLFH-IASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMT 206

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           +PL  YY+  G    +D    M +V   IDS+     +K
Sbjct: 207 VPLVDYYQKHGVHVKVDAAKPMADVKAHIDSVFAKFTQK 245


>gi|72163024|ref|YP_290681.1| adenylate kinase [Thermobifida fusca YX]
 gi|123628781|sp|Q47LL4|KAD_THEFY RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|71916756|gb|AAZ56658.1| Adenylate kinase [Thermobifida fusca YX]
          Length = 189

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 114/185 (61%), Gaps = 6/185 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  L+ KL++P++STGD+ RA V   T LGK+ +  M+ G L+ 
Sbjct: 1   MRVVLVGPPGAGKGTQAQILASKLSIPKVSTGDIFRANVSGGTELGKKAQAYMDRGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V DR+   D  +GF+LDG+PR + QA++L   ++++   +D V+EL V++  +
Sbjct: 61  DEITNAMVRDRLAEDDARAGFLLDGFPRNLAQAETLDEMLADLGVKLDVVLELVVDEEEV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +    RSDD  +    R+  YR+   PL S+Y   G L  ID +  +
Sbjct: 121 IRRLAER------ARIDNRSDDNEETIRHRLVVYREQTAPLVSFYEKRGLLEKIDAVGPI 174

Query: 181 DEVSR 185
           +EV++
Sbjct: 175 EEVTQ 179


>gi|291437818|ref|ZP_06577208.1| adenylate kinase [Streptomyces ghanaensis ATCC 14672]
 gi|291340713|gb|EFE67669.1| adenylate kinase [Streptomyces ghanaensis ATCC 14672]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 115/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++KL +P +STGD+ RA + R T LGK  K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATRLAEKLRIPHISTGDLFRANISRQTELGKLAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +      +DAV++L   +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAQALDELLETEGIELDAVLDLEAPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRICRKDSSHVFHLTYSPPAKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G +  I     ++EV+ R++++L
Sbjct: 181 EPIIDYYKAQGLVVTITATGRVEEVTGRALEAL 213


>gi|253701901|ref|YP_003023090.1| adenylate kinase [Geobacter sp. M21]
 gi|259494005|sp|C6E4N6|KAD_GEOSM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|251776751|gb|ACT19332.1| adenylate kinase [Geobacter sp. M21]
          Length = 214

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG GKGTQA  L  +  +PQ+STGD+LRA V   T +G + KG M+SG+L+ 
Sbjct: 1   MNLILLGPPGVGKGTQAKLLIDRFGIPQISTGDILRAAVKELTPMGAKAKGYMDSGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DC  GFILDG+PRTV QA +L   +S M  +ID V+ L V+   +
Sbjct: 61  DEVVIGIVEERLAQEDCQKGFILDGFPRTVPQADALGQVLSGMGKSIDHVVSLSVDKEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +A + +   R DDK +  L R+  Y     
Sbjct: 121 LTRLTGRRACANCGAGYHVDFAPSKVAGVCDACSGQLVQREDDKEETILNRLSVYEAQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL +YY+  G L  +DG+  ++ V   I
Sbjct: 181 PLIAYYQAAGVLRSVDGLGTVEAVQGDI 208


>gi|224493082|sp|A8XZJ0|KAD2_CAEBR RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2; AltName:
           Full=Lethal protein 754
 gi|309355911|emb|CAP37989.2| hypothetical protein CBG_21240 [Caenorhabditis briggsae AF16]
          Length = 257

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 115/219 (52%), Gaps = 23/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R IF+GPPGSGKGTQA   + K     L+TGD+LRAEV   +  GKQ+K +M++G L+S
Sbjct: 38  IRAIFIGPPGSGKGTQAPAFASKYFSCHLATGDLLRAEVASGSEFGKQLKATMDAGKLVS 97

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++  ++  P+C  GFILDG+PRT  QA+ L   +      +D V+E  + D  +
Sbjct: 98  DDVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLL 157

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +RI  R+   IAS +S                       RSDD  +   KR+  Y +  
Sbjct: 158 VRRITGRLFH-IASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMT 216

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           +PL  YY+  G    +D    M +V   IDS+     +K
Sbjct: 217 VPLVDYYQKHGVHVKVDAAKPMADVKAHIDSVFAKFTQK 255


>gi|282164915|ref|YP_003357300.1| adenylate kinase [Methanocella paludicola SANAE]
 gi|282157229|dbj|BAI62317.1| adenylate kinase [Methanocella paludicola SANAE]
          Length = 216

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+  GPPG+GKGTQA  +S+K N+P +STGD+LR  V   T LGK+ K  M+ G+L+ 
Sbjct: 1   MQIVLFGPPGAGKGTQAKFISEKFNIPHISTGDILRENVREGTALGKKAKAFMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ DR++ PD   GF+LDG+PRT+ QA++L   +  ++  +DAV+ + V    +
Sbjct: 61  DEILIDIIKDRLQKPDTKRGFLLDGFPRTIAQAEALDPILDEINKKLDAVVNVDVSANEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R+DD       RI+ Y+    
Sbjct: 121 IRRLSGRRTCRSCGATYHVKSNPSRVAGVCDQCGGELYQRADDTEAAIKHRIDVYKNQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G L  +DG  ++DEV   I
Sbjct: 181 PLIDYYRKKGLLMDVDGEREIDEVRSDI 208


>gi|125975405|ref|YP_001039315.1| adenylate kinase [Clostridium thermocellum ATCC 27405]
 gi|256005308|ref|ZP_05430274.1| adenylate kinase [Clostridium thermocellum DSM 2360]
 gi|166219985|sp|A3DJJ3|KAD_CLOTH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|125715630|gb|ABN54122.1| Adenylate kinase [Clostridium thermocellum ATCC 27405]
 gi|255990744|gb|EEU00860.1| adenylate kinase [Clostridium thermocellum DSM 2360]
 gi|316939521|gb|ADU73555.1| adenylate kinase [Clostridium thermocellum DSM 1313]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 115/216 (53%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  +SQK NVP +STGD+ R+ +   T LG++ K  ++ G L+ 
Sbjct: 1   MRLVLLGAPGAGKGTQAVVISQKYNVPHISTGDIFRSNIKNGTELGRKAKEYIDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GFILDG+PRT+ QA+ L   +  ++  +D  + + V D  +
Sbjct: 61  DELTVDIVKDRISQPDCKAGFILDGFPRTIYQAERLDEILKELNVELDCALNIYVPDEEI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + ++   E   R DDK +  ++R+  Y K   
Sbjct: 121 IKRMSGRRVCSKCGMSYHIVYNQPKVENICDSCNGELIQRDDDKEETVIQRLNTYHKQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY   G L  + G   +D+ ++ + + L  V+
Sbjct: 181 PLIEYYEKKGKLLTVHGQEGVDDTTKEVLNALSGVK 216


>gi|170058306|ref|XP_001864865.1| adenylate kinase 1 [Culex quinquefasciatus]
 gi|224493071|sp|B0X5E3|KAD2_CULQU RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|167877445|gb|EDS40828.1| adenylate kinase 1 [Culex quinquefasciatus]
          Length = 241

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 117/214 (54%), Gaps = 23/214 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + +G Q+K  M+ G L+SD +
Sbjct: 23  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIAAGSKIGAQLKKVMDEGKLVSDDL 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +   +  +DAVIE  ++D+ + +R
Sbjct: 83  VVDMIDSNLDKPECRNGFLLDGFPRTVVQAEKLDQLLDKRNTGLDAVIEFGIDDSLLVRR 142

Query: 124 IQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTILPL 161
           I  R++   AS +S                       RSDD     +KR+E+Y K   PL
Sbjct: 143 ITGRLIHQ-ASGRSYHEEFHPPKVAMTDDVTGEPLMRRSDDNAHALVKRLESYHKQTKPL 201

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           + YY   G  + +D      +V   IDS+ +  R
Sbjct: 202 ADYYALRGLHFRVDAARSASQVFEHIDSIFMKQR 235


>gi|326332212|ref|ZP_08198492.1| adenylate kinase (ATP-AMP transphosphorylase) [Nocardioidaceae
           bacterium Broad-1]
 gi|325949918|gb|EGD41978.1| adenylate kinase (ATP-AMP transphosphorylase) [Nocardioidaceae
           bacterium Broad-1]
          Length = 191

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA  +++   +P +STGD+ RA V + T LG +    M+ G  + 
Sbjct: 1   MRLIIMGPPGAGKGTQAKFIAEHFGIPAISTGDIFRANVSQGTPLGIEAASYMDKGEYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N +V +RI  PD   GF+LDGYPRT+ Q + L   I     A+DAV+ L V+   +
Sbjct: 61  DSVTNLMVRNRIDEPDAAKGFLLDGYPRTLAQVEELDGMIKFTGHALDAVVVLTVDKDEI 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  DV  +R E Y +   PL   Y+  G ++ IDGM ++
Sbjct: 121 VQRLLQR------AELEGRADDTEDVIRRRQEVYLEETAPLIEVYKGRGLVHEIDGMGEV 174

Query: 181 DEVSRSI 187
           D+V++ I
Sbjct: 175 DDVTKRI 181


>gi|164686548|ref|ZP_02210576.1| hypothetical protein CLOBAR_00115 [Clostridium bartlettii DSM
           16795]
 gi|164604417|gb|EDQ97882.1| hypothetical protein CLOBAR_00115 [Clostridium bartlettii DSM
           16795]
          Length = 215

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 114/214 (53%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  + +K  +P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAAGIVEKYKIPHISTGDIFRQNIKEGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GF+LDG+PR V QA  L AF+ N   A+D VI + V+   +
Sbjct: 61  DELTVGLVTDRISQPDCGNGFMLDGFPRNVSQAVQLDAFLKNNGIALDKVINIEVDKEKL 120

Query: 121 FKR-IQVRVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R +  R+ ++  +   +                    R+DD  +   KRI+ Y     
Sbjct: 121 VARAVGRRICKSCGATYHIEFNPSKEEGVCDICKGDLYQRADDNEETVSKRIQVYLDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL+ YY  +G +  IDG   +D+V   I S L S
Sbjct: 181 PLADYYSKVGIIADIDGQQSIDKVFNDIVSALES 214


>gi|188584857|ref|YP_001916402.1| Adenylate kinase [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|229487586|sp|B2A4G2|KAD_NATTJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|179349544|gb|ACB83814.1| Adenylate kinase [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 214

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 116/208 (55%), Gaps = 23/208 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA +LS++L+VP ++TGD+ R  V   T LGK+ K  M++G L+ 
Sbjct: 1   MRIILMGPPGAGKGTQAEKLSKELDVPHIATGDIFRKAVSEGTELGKEAKSYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R++ PDC  GFILDG+PRTV QA++L   +S  D  + A + + V    +
Sbjct: 61  DDVVIGIVEERLKKPDCHEGFILDGFPRTVTQAEALDKVLS--DNPLTAAVYIDVSKDEL 118

Query: 121 FKRI--------------------QVR-VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+                    QVR V +    E   R DD  +   +R+E Y +   
Sbjct: 119 IDRLSGRRICRKCGKSYHIKFNPPQVRGVCDEDEGELYQRDDDNEETAKERLEVYLENTQ 178

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+D G L  IDG    +EV R I
Sbjct: 179 PLVEYYQDRGILKKIDGTKSPEEVFRDI 206


>gi|254511390|ref|ZP_05123457.1| adenylate kinase [Rhodobacteraceae bacterium KLH11]
 gi|221535101|gb|EEE38089.1| adenylate kinase [Rhodobacteraceae bacterium KLH11]
          Length = 227

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 109/211 (51%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L  K  + QLSTGD+LR  V   T  GK  K  ME+G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARMLEDKFGLVQLSTGDLLRGAVAAGTEAGKAAKAVMEAGDLVSDG 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC  G ILDG+PRT  QA++L   +++ D  I+A I L V+D  M  
Sbjct: 72  IVTAILRDRMAETDCAKGVILDGFPRTTVQAEALDGLLASTDQKINAAISLEVDDTEMVT 131

Query: 123 RIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A   E                       + R+DD  +    R+  Y     P
Sbjct: 132 RISGRYTCAGCGEGYHDTYKQPAEDGKCDKCGHTEFTRRADDNAETVASRLSAYHAQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY+  G L  ID M  +D+++R + +L+
Sbjct: 192 LIDYYQAQGVLKGIDAMGQIDDIARDLQALV 222


>gi|256380577|ref|YP_003104237.1| adenylate kinase [Actinosynnema mirum DSM 43827]
 gi|255924880|gb|ACU40391.1| adenylate kinase [Actinosynnema mirum DSM 43827]
          Length = 183

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 116/191 (60%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  LS  L VP +STGD+ RA +   T LG +V+  +++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAKNLSAALAVPHISTGDLFRAHISEQTPLGLEVQEYLDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V +R+  PD  +GF+LDG+PR V QA  L A +++    +DAV+E R+++  +
Sbjct: 61  DEVTNKMVRERLAEPDAANGFLLDGFPRNVAQADVLGALLASEGHELDAVLEFRIDEEIV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DDK DV   R + YR    PL  YY  +  +  ID + D+
Sbjct: 121 VERLLAR----------GRADDKEDVIRHRQQVYRTETAPLLEYYSRI--VVTIDAVGDV 168

Query: 181 DEVS-RSIDSL 190
            E+S R++ +L
Sbjct: 169 TEISERALAAL 179


>gi|163760821|ref|ZP_02167900.1| adenylate kinase [Hoeflea phototrophica DFL-43]
 gi|162281865|gb|EDQ32157.1| adenylate kinase [Hoeflea phototrophica DFL-43]
          Length = 161

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 103/161 (63%)

Query: 34  MLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQA 93
           MLRA V   T +GK+ K  M++G L+SD IVN +V +RI  PDC  GFILDGYPRT+ QA
Sbjct: 1   MLRAAVAAGTEVGKRAKAVMDAGELVSDDIVNAIVSERIDQPDCARGFILDGYPRTLVQA 60

Query: 94  KSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIEN 153
            ++ A +++ D  +D+VIEL V+D ++  RI  R  EA A+ + VR DD  +VF +R+  
Sbjct: 61  DAVEAMLASKDMKLDSVIELIVDDKALVGRIVKRAEEAAAAGQPVRKDDNPEVFDERLRE 120

Query: 154 YRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           Y K   PL+ YY   G L  +DGM  +D VS  I+ +L S+
Sbjct: 121 YYKKTAPLTGYYYAKGVLRNVDGMKTIDAVSEEIEQVLASL 161


>gi|2924292|emb|CAA58138.1| AdK adenylate kinase [Streptomyces coelicolor A3(2)]
          Length = 217

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 109/207 (52%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++ L++P +STGD+ RA + + T LGK  K  M +G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATRLAETLHIPHISTGDLFRANISQQTELGKLAKSYMNAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +      +DAV++L   +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLETEGMKLDAVLDLEAPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRVCRNEPKHVFHVTYTPPKKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I     +DEV+R
Sbjct: 181 EPIIDYYKSQGLVATIAATGPVDEVTR 207


>gi|307721117|ref|YP_003892257.1| adenylate kinase [Sulfurimonas autotrophica DSM 16294]
 gi|306979210|gb|ADN09245.1| Adenylate kinase [Sulfurimonas autotrophica DSM 16294]
          Length = 216

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 124/219 (56%), Gaps = 33/219 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L++K N+PQ+STGDMLRA +   T +GK  K +M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFLTKKYNIPQISTGDMLRAAIKAGTEMGKMAKAAMDAGQLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DRI   DC +G++LDG+PRT+ QA +    ++N    IDAVIE+ V D  +
Sbjct: 61  DDIIIGLVKDRIAQDDCKNGYLLDGFPRTLPQADA----VTNAGIEIDAVIEIDVADEEI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            KR+  R    +AS ++                       R DDK  V L R++ Y +  
Sbjct: 117 VKRMSGRRAH-LASGRTYHVIYNPSKIEGKDDETGEDLVQRDDDKEAVVLDRLKVYHEQT 175

Query: 159 LPLSSYYRDMG-----CLYI-IDGMLDMDEVSRSIDSLL 191
            PL  YY+ +        YI +DG  D+ +V ++I S L
Sbjct: 176 EPLIGYYKALAKKNPNLKYITVDGTADIADVEKAIVSEL 214


>gi|300782631|ref|YP_003762922.1| adenylate kinase [Amycolatopsis mediterranei U32]
 gi|299792145|gb|ADJ42520.1| adenylate kinase [Amycolatopsis mediterranei U32]
          Length = 184

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 113/183 (61%), Gaps = 12/183 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA  LS++L VP +STGD+ RA V + T LG++ K  ++SG L+ D
Sbjct: 3   RLVLVGPPGAGKGTQAVALSEQLRVPHISTGDLFRAHVGQETPLGQEAKRYLDSGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N++V +R+  PD   GF+LDG+PR   QA+ L   + + D ++DAVI+L+V +  + 
Sbjct: 63  SVTNEMVRERLAEPDAKVGFLLDGFPRNTKQAEVLGEILGDADVSLDAVIQLQVPEDVVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R           R+DD  +V  +R + Y     PL  YY D+  L  +DG+  ++
Sbjct: 123 GRLMSR----------GRADDTEEVIRRRQQIYVSDTAPLLEYYADI--LVTVDGVGSVE 170

Query: 182 EVS 184
           E+S
Sbjct: 171 EIS 173


>gi|58377938|ref|XP_308155.2| AGAP007722-PA [Anopheles gambiae str. PEST]
 gi|74921611|sp|Q7QJX9|KAD2_ANOGA RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|55245178|gb|EAA04739.2| AGAP007722-PA [Anopheles gambiae str. PEST]
          Length = 240

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 116/213 (54%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG Q+K  M+ G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKYCVCHLSTGDMLRAEIASGSKLGAQLKKVMDEGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +   +  +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECRNGFLLDGFPRTVVQAEKLDNLLEKRNTGLDAVIEFGIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD     +KR+E+Y +   PL+
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKVPMRDDETGEPLMRRSDDNAQALVKRLESYHRQTKPLA 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +IDS+    R
Sbjct: 202 DYYALRGLHFRVDAAKSASDVFANIDSIFTKQR 234


>gi|145346144|ref|XP_001417553.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577780|gb|ABO95846.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 239

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 120/222 (54%), Gaps = 35/222 (15%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           I+  GPPG+GKGTQA ++++KL VPQL+TGDMLRA V   T +G++ K +M+SG L++D 
Sbjct: 15  IVIFGPPGAGKGTQAPKITEKLGVPQLATGDMLRAAVAAGTDVGRRAKAAMDSGGLVTDD 74

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI   DC  GFILDG+PRT++QAK L   ++     +D V+ L V D+ + K
Sbjct: 75  IVVAIIRDRIAAKDCARGFILDGFPRTIEQAKKLDEMLAKRGEKVDVVVSLEVPDSLLEK 134

Query: 123 RIQVRVLEAIASE---------KSV------------------------RSDDKYDVFLK 149
           RI  R +   +           KS+                        RSDD  +  + 
Sbjct: 135 RICGRWVHKASGRSYHATFNPPKSLKACPGKQAKPKRMFDDETGEQLEQRSDDTKEALVT 194

Query: 150 RIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           R+E Y     P+  +Y  +  +  ID   DM EV  +I+++L
Sbjct: 195 RLEAYHSQTKPILEHYSPV--VAKIDAAKDMSEVWTAIEAVL 234


>gi|254383151|ref|ZP_04998505.1| adenylate kinase [Streptomyces sp. Mg1]
 gi|194342050|gb|EDX23016.1| adenylate kinase [Streptomyces sp. Mg1]
          Length = 215

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 117/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LG++ K  ME+G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLSIPHISTGDLFRANISKGTELGRKAKAIMEAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +  DR+   D   GF+LDG+PR V QA++L A++   D  +DAV++L VE+  +
Sbjct: 61  DEITIAMAQDRMEQADAAGGFLLDGFPRNVSQAEALDAYLKAGDLKLDAVLDLEVEEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +    R++ Y    
Sbjct: 121 VKRIAGRRVCRNDSSHVFHVTYAAPKTEGVCDTCGGELYQRGDDSEETVRNRLDVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G L  I  + ++ +V+ R++D+L
Sbjct: 181 EPIIDYYKAQGLLVTIPALGEVADVTQRAMDAL 213


>gi|296272669|ref|YP_003655300.1| adenylate kinase [Arcobacter nitrofigilis DSM 7299]
 gi|296096843|gb|ADG92793.1| adenylate kinase [Arcobacter nitrofigilis DSM 7299]
          Length = 212

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  L +K N+PQ+STGD+LRA +   T +G + K  M+ G L+ 
Sbjct: 1   MNLMLFGAPGAGKGTQAKFLIEKYNIPQISTGDILRAAIADKTDMGMEAKKFMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC +GFILDG+PRT+ QA++L   +SNM+ ++D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLAEDDCKNGFILDGFPRTLAQAEALSELMSNMEISLDKVISLNVPDELI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R                     V +    E  +R DD  +    R+E Y     
Sbjct: 121 VGRITGRRVCSKCGASFHVEFNPSKEENVCDYCGGELVIRKDDNAETVKSRLEAYHAQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y DMG    +DG  D+ +V++ + + L
Sbjct: 181 PLIDFYTDMGVFVELDGTKDVSDVTKDMIAAL 212


>gi|291457224|ref|ZP_06596614.1| adenylate kinase [Bifidobacterium breve DSM 20213]
 gi|291381059|gb|EFE88577.1| adenylate kinase [Bifidobacterium breve DSM 20213]
          Length = 186

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGLEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC +G+ILDGYPR   Q  +L   ++++   +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCANGWILDGYPRNAAQVTALDEMLADLGTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYESRGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+SR I S L
Sbjct: 175 DEISRRIISHL 185


>gi|296130468|ref|YP_003637718.1| adenylate kinase [Cellulomonas flavigena DSM 20109]
 gi|296022283|gb|ADG75519.1| adenylate kinase [Cellulomonas flavigena DSM 20109]
          Length = 192

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 6/194 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ LGPPG+GKGTQA RL+++L VP +STGD+ R+ +   T LGK+V+    SG+L+ D
Sbjct: 4   RLVLLGPPGAGKGTQAARLAERLGVPAVSTGDIFRSNIKNGTELGKRVQDITASGALVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V DR+   D   GF+LDGYPR V Q  +L   ++     +D  IEL V+   + 
Sbjct: 64  ELTNELVRDRLAQADAVEGFLLDGYPRNVAQVAALDEMLAVAGRELDLAIELTVDPQVVV 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      +E   R+DD  DV   R++ Y +   P+S  Y   G L  +DG+ D+D
Sbjct: 124 DRLTRR------AEIEGRADDTEDVIRHRLDVYAEQTAPISQVYAARGLLAQVDGLGDVD 177

Query: 182 EVSRSIDSLLVSVR 195
           +V+  + + L   R
Sbjct: 178 DVTARLLAALSGAR 191


>gi|32141245|ref|NP_733646.1| adenylate kinase [Streptomyces coelicolor A3(2)]
 gi|19859626|sp|P43414|KAD_STRCO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|24429536|emb|CAD55214.1| adenylate kinase [Streptomyces coelicolor A3(2)]
          Length = 217

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 109/207 (52%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL++ L++P +STGD+ RA + + T LGK  K  M +G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATRLAETLHIPHISTGDLFRANISQQTELGKLAKSYMNAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD + GF+LDG+PR V QA++L   +      +DAV++L   +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAEGGFLLDGFPRNVSQAEALDELLETEGMKLDAVLDLEAPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRVCRNEPKHVFHVTYTPPKKEGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I     +DEV+R
Sbjct: 181 EPIIDYYKSQGLVATIAATGPVDEVTR 207


>gi|154483167|ref|ZP_02025615.1| hypothetical protein EUBVEN_00868 [Eubacterium ventriosum ATCC
           27560]
 gi|149735975|gb|EDM51861.1| hypothetical protein EUBVEN_00868 [Eubacterium ventriosum ATCC
           27560]
          Length = 214

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +++K ++P +STGD+ RA +   T LGK++K  +++G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKMIAEKYSIPHISTGDIFRANIKNGTELGKKLKLFIDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR +  DC +G++LDG+PRT+ QA++L   +  +   +D  I++ V D ++
Sbjct: 61  DELVVDLVIDRFKEDDCKNGYVLDGFPRTIPQAEALDNALKAIGDKVDFAIDVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +    E  VR DDK +  L R+E Y     
Sbjct: 121 VRRMGGRRACVGCGATYHVVYNPTKEEGTCDTCGGELIVRDDDKPETVLSRLEVYHNQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++ G L  +DG +DM +V ++I  +L
Sbjct: 181 PLIDYYKEQGILKSVDGTVDMKDVFKAIVEIL 212


>gi|328755526|gb|EGF69142.1| adenylate kinase [Propionibacterium acnes HL025PA2]
          Length = 189

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNATELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AETEGRADDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|213693067|ref|YP_002323653.1| adenylate kinase [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|213524528|gb|ACJ53275.1| adenylate kinase [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|320459245|dbj|BAJ69866.1| adenylate kinase [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 186

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGLEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC +G+ILDGYPR   Q  +L   ++++D  +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCKNGWILDGYPRNAAQVTALDEMLADLDTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYESRGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+S  I S L
Sbjct: 175 DEISGRIISHL 185


>gi|321470818|gb|EFX81793.1| hypothetical protein DAPPUDRAFT_317306 [Daphnia pulex]
          Length = 233

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 119/216 (55%), Gaps = 23/216 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA RL +K  V  L+TGDMLRAEV   + LGK +K +M+ G L+SD +
Sbjct: 13  ILLGPPGSGKGTQAPRLKEKYCVCHLATGDMLRAEVASGSDLGKTLKKTMDEGLLVSDEL 72

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +S     +D+VIE  ++D+ + +R
Sbjct: 73  VVNLIDANLSKPECKNGFLLDGFPRTVVQAEKLDGLLSERKKKLDSVIEFGIDDSLLVRR 132

Query: 124 IQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTILPL 161
           I  R++ + AS +S                       RSDD  +   KR+ +Y +   PL
Sbjct: 133 ICGRMIHS-ASGRSYHEEFHPPKEPMIDDVTGEPLIRRSDDNAETLTKRLVSYHQQTSPL 191

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
             YY   G    +D  L   EV R+I+ +    + K
Sbjct: 192 VEYYSKKGIHTRVDASLSSHEVFRNIEKIFSGAKSK 227


>gi|229489511|ref|ZP_04383374.1| adenylate kinase [Rhodococcus erythropolis SK121]
 gi|229323608|gb|EEN89366.1| adenylate kinase [Rhodococcus erythropolis SK121]
          Length = 181

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 117/191 (61%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+K  VP +STGD+ RA + + T LG + K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKFGVPHISTGDLFRANIGQATALGVEAKKYIDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            +I N +V  R+  PD  +GF+LDG+PR+V+QA++L   + ++D  +D V+   V++  +
Sbjct: 61  SSITNDMVKARVAEPDAANGFLLDGFPRSVEQAQALEGILKDLDTKLDGVLSFVVDEDIV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  DV   R+  YR    PL  YY+D   +  +D + ++
Sbjct: 121 VERMLAR----------GRADDTEDVIRNRLRVYRDETSPLFDYYKD--SIVSVDAIGEV 168

Query: 181 DEV-SRSIDSL 190
           +EV +R++ +L
Sbjct: 169 EEVNARALAAL 179


>gi|302871518|ref|YP_003840154.1| adenylate kinase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574377|gb|ADL42168.1| adenylate kinase [Caldicellulosiruptor obsidiansis OB47]
          Length = 215

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 114/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS++ ++P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEYLSKRFSIPHISTGDILRENVKNETELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V DRI   DC +GF+LDG+PRT+ QA++L   +  +   ID V+++ V D  +
Sbjct: 61  DEIVIEIVKDRISKEDCKNGFLLDGFPRTIAQAEALDKVLQELGQKIDKVLDIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKNCGASFHVIYRPPQKEGVCDVCGGELYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+  G L ++ G  ++ + ++ +
Sbjct: 181 PLIDYYKAKGLLVVVYGQEEIADTTKEV 208


>gi|195382533|ref|XP_002049984.1| GJ20444 [Drosophila virilis]
 gi|224493085|sp|B4LP08|KAD2_DROVI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|194144781|gb|EDW61177.1| GJ20444 [Drosophila virilis]
          Length = 240

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 117/218 (53%), Gaps = 24/218 (11%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M+ G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLQKKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDEGKLVSDDL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +     ++DAVIE  ++D  + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAQKLDTLLDKRRTSLDAVIEFAIDDNLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  D   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKVQMKDDITGEPLIKRSDDNVDALKKRLEAYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSS 200
            YY   G  + +D      +V  SIDS+    ++KC S
Sbjct: 202 DYYGLRGLHFKVDAAKKASDVFSSIDSIF---QRKCYS 236


>gi|296116712|ref|ZP_06835322.1| adenylate kinase [Gluconacetobacter hansenii ATCC 23769]
 gi|295976924|gb|EFG83692.1| adenylate kinase [Gluconacetobacter hansenii ATCC 23769]
          Length = 219

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 119/219 (54%), Gaps = 22/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M IIFLGPPG+GKGTQ+  L     + Q+STGDMLRAEV  ++ LGK+VK  M SG L+ 
Sbjct: 1   MNIIFLGPPGAGKGTQSKLLEAHYGIAQISTGDMLRAEVAADSPLGKKVKSVMASGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  RI  PDC  GFILDG+PRT  QA++L + +      ID V+ L V++ ++
Sbjct: 61  DDLIIALIEARIDRPDCARGFILDGFPRTRAQAEALDSMLKKTGRHIDLVLLLDVDEDAL 120

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             RI  R   A   E                         R DD+ +    R++ YR+  
Sbjct: 121 ADRIAGRFTCAKCGEGYNDLYKRPRVEGTCDVCGGHDFVRREDDRRETVAARLKAYREQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
            P+  YY   G L  IDGM D+D+V++ + + +  + KK
Sbjct: 181 APILPYYEGHGRLCRIDGMADIDDVTKQVFAAVDGITKK 219


>gi|284053322|ref|ZP_06383532.1| adenylate kinase [Arthrospira platensis str. Paraca]
 gi|291567803|dbj|BAI90075.1| adenylate kinase [Arthrospira platensis NIES-39]
          Length = 192

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 113/203 (55%), Gaps = 26/203 (12%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPGSGKGTQA R++Q + +P +STG++LR  V + T LG+Q K  M+ G L+ D 
Sbjct: 4   LIFLGPPGSGKGTQAARMAQIMKIPHISTGEILRDHVSKQTTLGQQAKTYMDLGDLVPDQ 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDA------------V 110
           ++  +V  R+  PD ++G+ILDG+PR V QA+    F+     A+D             V
Sbjct: 64  LILDMVTHRLSEPDAETGWILDGFPRNVSQAQ----FVQEHLLAVDEKTGKIPDKDHVWV 119

Query: 111 IELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGC 170
           I L V D  + KR+ VR           R DD  +  L R++ YR+   PL  +Y     
Sbjct: 120 INLEVPDDVILKRLLVR----------GREDDHEETILHRLQVYREQTAPLIEFYSSRNQ 169

Query: 171 LYIIDGMLDMDEVSRSIDSLLVS 193
           L+ I+G   M+EV+ S+  ++ S
Sbjct: 170 LHHINGDRSMEEVTDSLKEVITS 192


>gi|312880351|ref|ZP_07740151.1| Adenylate kinase [Aminomonas paucivorans DSM 12260]
 gi|310783642|gb|EFQ24040.1| Adenylate kinase [Aminomonas paucivorans DSM 12260]
          Length = 215

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 116/209 (55%), Gaps = 21/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  + ++  +P LSTGDMLR  V R T+LG + K  M+SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAASVIERFTIPHLSTGDMLRDHVKRGTVLGVEAKSFMDSGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DR+R  DC  GF+LDG+PRT+ QA++L A +S +  ++DAV+ L V D  +
Sbjct: 61  DGLIIAMMEDRLRQEDCGRGFLLDGFPRTLPQAEALDALLSRLGVSLDAVVLLDVTDGVV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    E   R DD+ DV  KR+  Y +   
Sbjct: 121 VERLCGRRVCKDCGAIYHVSFHPSRVSGICDLCGGELVQRDDDREDVIRKRLGVYHEQTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSID 188
           PL +YY     L  ++     D V R+++
Sbjct: 181 PLVAYYEKQDILRRVNAEGAPDAVCRNLE 209


>gi|67923558|ref|ZP_00517031.1| Adenylate kinase, subfamily [Crocosphaera watsonii WH 8501]
 gi|67854584|gb|EAM49870.1| Adenylate kinase, subfamily [Crocosphaera watsonii WH 8501]
          Length = 190

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 116/190 (61%), Gaps = 6/190 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPGSGKGTQA  LS++LN+P +STG+MLRA + + T LG++ +  M+ G L+ D 
Sbjct: 7   LIFLGPPGSGKGTQAQELSKELNIPHISTGEMLRAAIAKQTSLGQKAQVYMDKGELVPDE 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++  ++ +R++  D ++G+ILDG+PR V QA+ L   +  +    +  I L V D  +  
Sbjct: 67  LLLGLIEERLKEKDAENGWILDGFPRNVAQAEFLDKLLHKLAKFSEQAINLDVPDPVIID 126

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+ +R       +K  R DD  +   +R+E YR+   P+  YYR    L  +DG  ++ E
Sbjct: 127 RLLLR------GQKEGRKDDNEETIRRRLEVYREKTQPVLDYYRQQDRLSSVDGNRELQE 180

Query: 183 VSRSIDSLLV 192
           V++++ +++ 
Sbjct: 181 VTKTLKAVVT 190


>gi|304315961|ref|YP_003851106.1| adenylate kinase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302777463|gb|ADL68022.1| adenylate kinase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 216

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+++   +P +STGD+ R  +  NT LGK  K   E G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAERITKDYEIPHISTGDIFRYNIKNNTELGKLAKQYTEKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR V QA+SL  ++ N    ID V+ + V+   +
Sbjct: 61  DDVTNKIVEDRLTKDDCKDGFLLDGYPRNVIQAESLGKYLENKGLKIDHVLNIIVDRDEL 120

Query: 121 FKRIQVR-----------------VLEAI---ASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+  R                  +E I     EK + R+DD  +  LKR+E Y     
Sbjct: 121 VKRLSGRRVCPSCGATYHIVTKPPKVEGICDHCGEKLIQRTDDNIESVLKRLEVYEDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY  +  +  IDG   ++EV + I  L+
Sbjct: 181 PLVEYYGKLNLIRNIDGNKPVNEVYKEIQILI 212


>gi|284049236|ref|YP_003399575.1| adenylate kinase [Acidaminococcus fermentans DSM 20731]
 gi|283953457|gb|ADB48260.1| adenylate kinase [Acidaminococcus fermentans DSM 20731]
          Length = 214

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 106/204 (51%), Gaps = 21/204 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA +L     +P +STGDM RA V   T LGK+ K  M++G L+ 
Sbjct: 1   MHILLMGPPGAGKGTQAEKLVADFPIPHISTGDMFRAAVKNGTELGKEAKKYMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V +R+  PDC  GFILDG+PRT +QA++L   + N+   + A + + V D  +
Sbjct: 61  DSVTIGIVRERLSQPDCAKGFILDGFPRTKEQAEALDEILKNLGITLTAAVNISVPDEDL 120

Query: 121 FKRI---------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+                     Q  V +    E   R DDK     KR+E Y     
Sbjct: 121 VARVTGRRICKNCGATYHVVYNPPKQENVCDKCGGELYQRDDDKETTVKKRLEAYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEV 183
           PL +YY+  G    IDG   +D+V
Sbjct: 181 PLIAYYKAEGVYREIDGTQPIDKV 204


>gi|294786432|ref|ZP_06751686.1| adenylate kinase (ATP-AMP transphosphorylase) [Parascardovia
           denticolens F0305]
 gi|315225994|ref|ZP_07867782.1| adenylate kinase [Parascardovia denticolens DSM 10105]
 gi|294485265|gb|EFG32899.1| adenylate kinase (ATP-AMP transphosphorylase) [Parascardovia
           denticolens F0305]
 gi|315120126|gb|EFT83258.1| adenylate kinase [Parascardovia denticolens DSM 10105]
          Length = 189

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 114/194 (58%), Gaps = 6/194 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L+Q   +P +STGD+ R  +   T LGKQ +  M+ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAQHYGIPAISTGDIFRYNLKNQTELGKQAQAFMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+ + D   G+ILDGYPR   Q ++L + ++++   +D V+ L  +   +
Sbjct: 61  DQLTNAIVKDRLAMDDAKQGWILDGYPRNAAQVEALDSILTDLCTPLDRVVALHADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +V  KR++ Y K   PL + Y++ G L  +DG+  +
Sbjct: 121 MERMTKR------AEIEGRADDTPEVIAKRLDVYAKETEPLLAIYKERGLLLSVDGVGRI 174

Query: 181 DEVSRSIDSLLVSV 194
           DE+SR+I S L  V
Sbjct: 175 DEISRTIISQLDQV 188


>gi|23336309|ref|ZP_00121532.1| COG0563: Adenylate kinase and related kinases [Bifidobacterium
           longum DJO10A]
 gi|23466151|ref|NP_696754.1| adenylate kinase [Bifidobacterium longum NCC2705]
 gi|189440590|ref|YP_001955671.1| adenylate kinase [Bifidobacterium longum DJO10A]
 gi|227546497|ref|ZP_03976546.1| adenylate kinase [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239621031|ref|ZP_04664062.1| adenylate kinase [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|312133895|ref|YP_004001234.1| adk [Bifidobacterium longum subsp. longum BBMN68]
 gi|322689908|ref|YP_004209642.1| adenylate kinase [Bifidobacterium longum subsp. infantis 157F]
 gi|29427506|sp|Q8G3Z8|KAD_BIFLO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|23326888|gb|AAN25390.1| adenylate kinase [Bifidobacterium longum NCC2705]
 gi|189429025|gb|ACD99173.1| Adenylate kinase [Bifidobacterium longum DJO10A]
 gi|227213046|gb|EEI80925.1| adenylate kinase [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239516132|gb|EEQ55999.1| adenylate kinase [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|291516450|emb|CBK70066.1| Adenylate kinase [Bifidobacterium longum subsp. longum F8]
 gi|311773189|gb|ADQ02677.1| Adk [Bifidobacterium longum subsp. longum BBMN68]
 gi|320461244|dbj|BAJ71864.1| adenylate kinase [Bifidobacterium longum subsp. infantis 157F]
          Length = 186

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGLEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC +G+ILDGYPR   Q  +L   ++++D  +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCKNGWILDGYPRNAAQVTALDEMLADLDTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYEARGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+S  I S L
Sbjct: 175 DEISGRIISHL 185


>gi|119484813|ref|ZP_01619295.1| adenylate kinase [Lyngbya sp. PCC 8106]
 gi|119457631|gb|EAW38755.1| adenylate kinase [Lyngbya sp. PCC 8106]
          Length = 193

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 113/202 (55%), Gaps = 19/202 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +++IFLGPPGSGKGTQ+ RLS+ L VP +STGD+LR  V + T LG++ K  M+ G L+ 
Sbjct: 2   VQVIFLGPPGSGKGTQSARLSEFLAVPHISTGDILRTHVAQQTDLGQKAKAFMDQGDLVP 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFI---------SNMDCAIDAVI 111
           D ++  +V DR+  PD   G+ILDG+PR V QA  +   +          N D      I
Sbjct: 62  DQLILSMVQDRLDQPDAQKGWILDGFPRNVTQATFVEDLVKQQQVEKGSENADSKSLNTI 121

Query: 112 ELRVEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCL 171
            L V D  + +R+  R           R+DD  +    R++ Y +   PL  YYRD   L
Sbjct: 122 NLEVPDEVLIERLLAR----------GRADDSEETIRHRLQVYHEQTEPLIEYYRDRNQL 171

Query: 172 YIIDGMLDMDEVSRSIDSLLVS 193
            I++G L +D+V+ ++ + +V+
Sbjct: 172 SIVNGNLPLDQVTAALKNAIVA 193


>gi|217967389|ref|YP_002352895.1| nucleoside-triphosphate--adenylate kinase [Dictyoglomus turgidum
           DSM 6724]
 gi|217336488|gb|ACK42281.1| Nucleoside-triphosphate--adenylate kinase [Dictyoglomus turgidum
           DSM 6724]
          Length = 215

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 113/206 (54%), Gaps = 22/206 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           IIFLGPPG+GKGT A  +SQ LN+P +STGD+ R  V   T LG +VK  +++G L+ D 
Sbjct: 5   IIFLGPPGAGKGTHAKEVSQILNIPHISTGDIFREHVKNQTDLGIKVKSYLDAGKLVPDE 64

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V +VV DRI   DC +GFILDG+PRT+ QA+ L  ++   +  I  VI L   D  + +
Sbjct: 65  VVWEVVKDRIDKEDCKNGFILDGFPRTILQAEMLEKYLKEKNADI-KVIYLDAPDELVIR 123

Query: 123 RIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPL 161
           R+  R                     + +    E   RSDDK +V  +R+E Y K   PL
Sbjct: 124 RLSARRVCKNCGAIYNLISMPPKKDGICDICGGELYQRSDDKPEVIKQRLETYYKETQPL 183

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSI 187
             YY++   +Y I+   + +EV + I
Sbjct: 184 IDYYKNKDIMYTINAEKEREEVLKEI 209


>gi|297564058|ref|YP_003683031.1| adenylate kinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296848507|gb|ADH70525.1| adenylate kinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 219

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 117/205 (57%), Gaps = 21/205 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR + +GPPG+GKGTQA  L+ +L++P++STGD+ RA V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRAVLVGPPGAGKGTQAQILASELSIPKVSTGDIFRANVSGKTDLGKKAKEYMDRGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  +GF+LDG+PR V QA++L   ++++D  +D V+ELRV++  +
Sbjct: 61  DEVTNAMVRDRLAQEDAAAGFLLDGFPRNVPQAETLKGILADLDTTLDVVLELRVDEEEV 120

Query: 121 FKRI----------QVRVLEAIA-----------SEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+          QV  +E  A           +E   R DD+ +    R+E YR+   
Sbjct: 121 VKRLSGRRSCPECGQVYHVEYDAPKVAGRCDNEGAELYQREDDREETIRHRLEVYREQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS 184
           PL  +Y   G L  I     ++EV+
Sbjct: 181 PLVQFYEAEGLLATIAATGSVEEVT 205


>gi|282855178|ref|ZP_06264510.1| adenylate kinase [Propionibacterium acnes J139]
 gi|282581766|gb|EFB87151.1| adenylate kinase [Propionibacterium acnes J139]
          Length = 189

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 113/193 (58%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++   VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYRVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDNEETIRNRMKAYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|284992853|ref|YP_003411407.1| adenylate kinase [Geodermatophilus obscurus DSM 43160]
 gi|284066098|gb|ADB77036.1| adenylate kinase [Geodermatophilus obscurus DSM 43160]
          Length = 204

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (59%), Gaps = 1/191 (0%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  ++ +L VP +STGD+ RA V+  T LG Q K  M++G L+ 
Sbjct: 1   MRVVLLGPPGAGKGTQAQVIADRLGVPAISTGDIFRANVNGKTELGLQAKSYMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +V DR+   D   GF+LDG+PRT  QA+ L   +  +  A+D V+EL V++  +
Sbjct: 61  DEITVAMVKDRLAEDDAKGGFLLDGFPRTTAQAEQLRDSLHELGQALDCVLELVVDEDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R +  +  +   R DDK +    R++ YR+   PLS +Y   G L  ID +  +
Sbjct: 121 VRRLSGRRV-LVDGQWVQRDDDKPETVRHRLQVYREQTAPLSGWYDSEGLLTQIDAIGAV 179

Query: 181 DEVSRSIDSLL 191
           +EV++   S L
Sbjct: 180 EEVTQRAMSAL 190


>gi|114570324|ref|YP_757004.1| adenylate kinase [Maricaulis maris MCS10]
 gi|122315802|sp|Q0ANS1|KAD_MARMM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|114340786|gb|ABI66066.1| Adenylate kinase [Maricaulis maris MCS10]
          Length = 188

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 110/191 (57%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  GPPG GKGTQ+ RL  +    QLSTGDMLR      T LG++V   M+ G+L+S
Sbjct: 1   MNIVLFGPPGCGKGTQSKRLVAERGWVQLSTGDMLRHARAAGTELGRRVAAIMDGGNLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV +++ +R+       G I DG+PRTV QA++L   + +    +D+VIEL+V D  +
Sbjct: 61  DAIVIELIEERLPEAKAAGGAIFDGFPRTVAQAQALDQLLLDRGTQVDSVIELKVNDEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E+  R DD  DV  KR+E Y     PL  ++   G +  +DGM  M
Sbjct: 121 VQRLVKR------AEEEGRPDDTEDVIRKRLEVYYGQTAPLIPFFAQQGKVKAVDGMGSM 174

Query: 181 DEVSRSIDSLL 191
           DEV+  I + L
Sbjct: 175 DEVAAGIAAAL 185


>gi|325915272|ref|ZP_08177592.1| Adenylate kinase [Xanthomonas vesicatoria ATCC 35937]
 gi|325538465|gb|EGD10141.1| Adenylate kinase [Xanthomonas vesicatoria ATCC 35937]
          Length = 187

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 108/191 (56%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFEIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+  PD   GFILDGYPR V QA +L + +  +   +DAV++L V    +
Sbjct: 61  DDILLGMLESRLGQPDVAKGFILDGYPRNVAQANALDSLLGKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV   I   L
Sbjct: 175 DEVLERISKAL 185


>gi|78486397|ref|YP_392322.1| adenylate kinase [Thiomicrospira crunogena XCL-2]
 gi|123554939|sp|Q31DX5|KAD_THICR RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|78364683|gb|ABB42648.1| Adenylate kinase [Thiomicrospira crunogena XCL-2]
          Length = 215

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 121/219 (55%), Gaps = 33/219 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+ I LG PG+GKGTQA  L+++ N+PQ+STGDMLRA +   T +GK  K  M++G L++
Sbjct: 1   MKFILLGAPGAGKGTQAQFLTKEFNIPQISTGDMLRAAIKAQTPMGKMAKEFMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DRI  PDC +GF+LDG+PRTV QA +L A        IDAVIE+ V D+ +
Sbjct: 61  DEIIIGLVKDRIAEPDCANGFLLDGFPRTVPQADALKA----AGVEIDAVIEIDVPDSEI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             R+  R +   AS ++                       R DDK +V L R++ Y +  
Sbjct: 117 VNRMAGRRVHP-ASGRTYHITYNPPKVDDKDNETGDDLIQREDDKAEVVLDRLKVYHEQT 175

Query: 159 LPLSSYYRDMG-----CLYI-IDGMLDMDEVSRSIDSLL 191
            PL  YY+          YI +DG   +D V +SI S L
Sbjct: 176 APLIGYYKAEAEKNDQLKYIQVDGTQPIDTVEKSILSAL 214


>gi|188990287|ref|YP_001902297.1| adenylate kinase [Xanthomonas campestris pv. campestris str. B100]
 gi|229487647|sp|B0RP52|KAD_XANCB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|167732047|emb|CAP50237.1| adenylate kinase [Xanthomonas campestris pv. campestris]
          Length = 187

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 110/191 (57%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAARLKDTFQIPHISTGDLLRAEVAAGSPLGVKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D  +GFILDGYPR V QA +L + +S +   +DAV++L V    +
Sbjct: 61  DEILLGMLEARLGQADVANGFILDGYPRNVAQANALDSLLSKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV + I   L
Sbjct: 175 DEVLKRIGQAL 185


>gi|317483429|ref|ZP_07942419.1| adenylate kinase [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915115|gb|EFV36547.1| adenylate kinase [Bifidobacterium sp. 12_1_47BFAA]
          Length = 186

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGFEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC +G+ILDGYPR   Q  +L   ++++D  +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCKNGWILDGYPRNAAQVTALDEMLADLDTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYEARGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+S  I S L
Sbjct: 175 DEISGRIISHL 185


>gi|226305363|ref|YP_002765321.1| adenylate kinase [Rhodococcus erythropolis PR4]
 gi|259494015|sp|C0ZW47|KAD_RHOE4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|226184478|dbj|BAH32582.1| adenylate kinase [Rhodococcus erythropolis PR4]
          Length = 181

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 117/191 (61%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+K  VP +STGD+ RA + + T LG + K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKFGVPHISTGDLFRANIGQATALGVEAKKYIDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            +I N +V  R+  PD  +GF+LDG+PR+V+QA++L   + ++D  +D V+   V++  +
Sbjct: 61  SSITNDMVKARVAEPDAANGFLLDGFPRSVEQAQALEGILKDLDTRLDGVLSFVVDEDIV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  DV   R+  YR    PL  YY+D   +  +D + ++
Sbjct: 121 VERMLAR----------GRADDTEDVIRNRLRVYRDETSPLFDYYKD--SIVSVDAIGEV 168

Query: 181 DEV-SRSIDSL 190
           +EV +R++ +L
Sbjct: 169 EEVNARALAAL 179


>gi|254302850|ref|ZP_04970208.1| adenylate kinase [Fusobacterium nucleatum subsp. polymorphum ATCC
           10953]
 gi|148323042|gb|EDK88292.1| adenylate kinase [Fusobacterium nucleatum subsp. polymorphum ATCC
           10953]
          Length = 208

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 115/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 1   MNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANQTKLGLEAKKFMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V DA +
Sbjct: 61  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILTKLGKQIEKVIALNVPDADI 120

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 121 IERITGRRTSKVTGKIYHIKFNPPVDEKEEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 181 YKAQNKVTEIDGTKKLEDITQDIFKIL 207


>gi|154249796|ref|YP_001410621.1| adenylate kinase [Fervidobacterium nodosum Rt17-B1]
 gi|171769365|sp|A7HM31|KAD_FERNB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|154153732|gb|ABS60964.1| Adenylate kinase [Fervidobacterium nodosum Rt17-B1]
          Length = 218

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 120/218 (55%), Gaps = 21/218 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLGPPG+GKGT A R+ +K  +P +STGD+ R  + + T LG++V+  + SG+L+ 
Sbjct: 1   MNLIFLGPPGAGKGTYAKRVVEKYIIPHISTGDIFREAIAKGTELGRKVQDIVNSGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R++  DC  GFILDGYPRT++QA++L+  +  M   +D  I   V++ ++
Sbjct: 61  DELTNALVEERLKQDDCKKGFILDGYPRTLNQAQALNEMLKKMGKELDGAIYFEVDEETV 120

Query: 121 FKRIQVR--------VLEAIASEKSV-------------RSDDKYDVFLKRIENYRKTIL 159
            +RI  R        V   I     V             R DDK D+   R   Y +   
Sbjct: 121 VQRISTRRVCSKCGKVYNVITLPSKVEGICDDCGGTLIQRDDDKEDIVRSRYRVYIEKTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           PL  YY++   L+ +DG   ++EV + + ++L    KK
Sbjct: 181 PLIEYYKNQNKLFTLDGRKSVEEVMKILFNILGGFEKK 218


>gi|324999241|ref|ZP_08120353.1| adenylate kinase [Pseudonocardia sp. P1]
          Length = 184

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 112/191 (58%), Gaps = 12/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA ++++KL+VP +STGD+ RA +   T LG++ K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEQMAEKLDVPHISTGDLFRANLRDETELGREAKRYMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   D + GFILDG+PR   QA SL A +      +DAV++  VED  +
Sbjct: 61  DEVTVGMVKDRLGDADTEKGFILDGFPRNTAQAASLGAILDEKGLKLDAVVQFDVEDEVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           RSDD  D    R   YR+   PL  +YRD   L  ID + ++
Sbjct: 121 VQRLLGR----------GRSDDNEDTIRNRQRVYREETAPLLDHYRDQ--LVTIDAVGEI 168

Query: 181 DEVSRSIDSLL 191
           DE++  + S L
Sbjct: 169 DEITERVFSAL 179


>gi|254461618|ref|ZP_05075034.1| adenylate kinase [Rhodobacterales bacterium HTCC2083]
 gi|206678207|gb|EDZ42694.1| adenylate kinase [Rhodobacteraceae bacterium HTCC2083]
          Length = 192

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 109/189 (57%), Gaps = 1/189 (0%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II LGPPG+GKGTQA  L ++  + QLSTGDMLR   D  T +GK V   M  G L++D 
Sbjct: 4   IILLGPPGAGKGTQAAMLVEERGMIQLSTGDMLREAKDSGTEMGKVVADVMARGDLVTDE 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ ++++  D   GFI DG+PRT+ QA  L A ++     +D VIEL+V+D  +  
Sbjct: 64  IVIGLIREKLQ-GDKAGGFIFDGFPRTLAQADVLGALMAEQGETLDYVIELQVDDEVLVD 122

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           RI  R  EA+A+  + R+DD  +    R+  Y K   PL  YY   G L  +DG+  MD 
Sbjct: 123 RIVGRAAEAVAAGGTARADDNAESLKIRLMAYYKQTSPLIGYYHAKGMLKGVDGLGTMDG 182

Query: 183 VSRSIDSLL 191
           V   I  +L
Sbjct: 183 VKADIAGVL 191


>gi|50843290|ref|YP_056517.1| adenylate kinase [Propionibacterium acnes KPA171202]
 gi|289424839|ref|ZP_06426621.1| adenylate kinase [Propionibacterium acnes SK187]
 gi|68568765|sp|Q6A6Q4|KAD_PROAC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|50840892|gb|AAT83559.1| adenylate kinase [Propionibacterium acnes KPA171202]
 gi|289154802|gb|EFD03485.1| adenylate kinase [Propionibacterium acnes SK187]
 gi|313793285|gb|EFS41343.1| adenylate kinase [Propionibacterium acnes HL110PA1]
 gi|313837976|gb|EFS75690.1| adenylate kinase [Propionibacterium acnes HL086PA1]
 gi|314963515|gb|EFT07615.1| adenylate kinase [Propionibacterium acnes HL082PA1]
 gi|315077136|gb|EFT49203.1| adenylate kinase [Propionibacterium acnes HL053PA2]
 gi|315106044|gb|EFT78020.1| adenylate kinase [Propionibacterium acnes HL030PA1]
 gi|327332736|gb|EGE74470.1| adenylate kinase [Propionibacterium acnes HL097PA1]
 gi|327451576|gb|EGE98230.1| adenylate kinase [Propionibacterium acnes HL092PA1]
          Length = 189

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|195489453|ref|XP_002092744.1| GE14359 [Drosophila yakuba]
 gi|224493087|sp|B4PAR6|KAD2_DROYA RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|194178845|gb|EDW92456.1| GE14359 [Drosophila yakuba]
          Length = 240

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 115/213 (53%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +IDS+  + R
Sbjct: 202 DYYGLRGLHFKVDAAKKSSDVFSTIDSIFQNKR 234


>gi|307180051|gb|EFN68127.1| Adenylate kinase isoenzyme 2, mitochondrial [Camponotus floridanus]
          Length = 346

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 111/215 (51%), Gaps = 21/215 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA    ++  V  LSTGDMLRAEVD  + LG Q K  M+ G L+SD +
Sbjct: 21  VLLGPPGSGKGTQAVLFKERYCVCHLSTGDMLRAEVDSGSTLGIQFKKIMDEGKLVSDDL 80

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++ + +  P+C  GF+LDG+PR+V QA+ L   +      +DAVIE  ++D  +  R
Sbjct: 81  VVNMIENNLNKPECKRGFLLDGFPRSVPQAEKLDEMLKKRKTKLDAVIEFGIDDKLLISR 140

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E +A  K              RSDD  +   KR+  Y    LPL 
Sbjct: 141 ITGRLIHPASGRSYHETLAPPKVSMKDDITGEPLIKRSDDNEEALKKRLATYHTQTLPLV 200

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
            YY   G  Y I+     + V + ID + +   KK
Sbjct: 201 DYYALQGIHYYINAAQSAERVFKDIDQIFLRSTKK 235


>gi|315445950|ref|YP_004078829.1| adenylate kinase [Mycobacterium sp. Spyr1]
 gi|315264253|gb|ADU00995.1| Adenylate kinase [Mycobacterium sp. Spyr1]
          Length = 181

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 111/191 (58%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LGPPG+GKGTQA +L++KL +P +STGD+ R  +  NT LG + K  +++G L+ 
Sbjct: 1   MRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTELGIEAKKYLDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N +V DR+   D   GFILDG+PR+V+QAK+L   +      +DAV+E RV +  +
Sbjct: 61  ATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAKALAEMLEKRGLTLDAVVEFRVPEEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R DD  DV   R + YR    PL  +Y     L  +D + ++
Sbjct: 121 VSRLKGR----------GREDDTEDVIRNRFKVYRDETAPLLDFYS--ADLKTVDAVGEL 168

Query: 181 DEV-SRSIDSL 190
           DEV  R++ +L
Sbjct: 169 DEVFDRALTAL 179


>gi|255084960|ref|XP_002504911.1| predicted protein [Micromonas sp. RCC299]
 gi|226520180|gb|ACO66169.1| predicted protein [Micromonas sp. RCC299]
          Length = 245

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 118/224 (52%), Gaps = 39/224 (17%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I  GPPG+GKGT A ++  KL++PQLSTGDMLRA V   T +GK+ K +M+SG+L++D 
Sbjct: 18  LILFGPPGAGKGTHAPKIVDKLSIPQLSTGDMLRAAVAAGTEVGKKAKAAMDSGALVTDE 77

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI+  DC  GFILDG+PRT+ Q+K L   ++    A+  VIEL V DA + +
Sbjct: 78  IVVGIIADRIKEKDCVDGFILDGFPRTLAQSKMLDKELAKTGEAVSRVIELSVPDAVLTE 137

Query: 123 RIQVRVLEA-----------------------IASEKS---------------VRSDDKY 144
           RI  R +                         +  EK                 RSDD  
Sbjct: 138 RICGRWVHKSSGRSYHVKFNPPKSLAKLGGKDLNKEKDKTKWMKDDETGEALMQRSDDTA 197

Query: 145 DVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSID 188
           +  + R++ Y K  +P+  +Y    C+  ID   DMD +  SID
Sbjct: 198 EALVSRLDAYHKQTVPVLKHYGKKKCV-AIDANRDMDSIWASID 240


>gi|87199291|ref|YP_496548.1| adenylate kinase [Novosphingobium aromaticivorans DSM 12444]
 gi|123489944|sp|Q2G8V9|KAD_NOVAD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|87134972|gb|ABD25714.1| Adenylate kinase [Novosphingobium aromaticivorans DSM 12444]
          Length = 216

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 115/215 (53%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL ++  + QLSTGDMLRA V   T +G + K  ME+G L+S
Sbjct: 1   MNIILLGPPGAGKGTQAQRLVERHGMKQLSTGDMLRAAVKAETPVGLKAKAVMEAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ D +       G I DGYPRT  QA+SL A + +    +D VIEL V + ++
Sbjct: 61  DEIVSALIGDELDAMPAGQGAIFDGYPRTAPQAESLDAILESRGRKLDHVIELDVNEDAL 120

Query: 121 FKRIQVRV------------LEAIASEKSV----------RSDDKYDVFLKRIENYRKTI 158
            +RI  R              E  A E +           R DD  +    R+  YR   
Sbjct: 121 VERITGRYTCATCGKGYHDKFEKPAVEGTCDKCGGHEFKRRPDDNEETVRTRMAEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+   Y   G +  +DGM DMD+V+ +I+++L +
Sbjct: 181 APILPIYESRGIVSRVDGMADMDDVTAAIEAILAA 215


>gi|313828392|gb|EFS66106.1| adenylate kinase [Propionibacterium acnes HL063PA2]
 gi|314969902|gb|EFT14000.1| adenylate kinase [Propionibacterium acnes HL037PA1]
          Length = 189

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRADDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|217077304|ref|YP_002335022.1| adenylate kinase [Thermosipho africanus TCF52B]
 gi|226722887|sp|B7IHW7|KAD_THEAB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|217037159|gb|ACJ75681.1| adenylate kinase [Thermosipho africanus TCF52B]
          Length = 214

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++FLGPPG+GKGT A RL + LN+P +STGDM R  V   + LGK+V+  ++ G L+ 
Sbjct: 1   MNMVFLGPPGAGKGTYAKRLIEMLNIPHISTGDMFREAVASKSELGKKVEEILKRGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   DC +GFILDG+PRTV QAK+L   + ++   +D VI   V++  +
Sbjct: 61  DDLTNSIVKDRLSKEDCKNGFILDGFPRTVAQAKALDEIMRSLGKDLDYVIYFEVDEEEV 120

Query: 121 FKRIQVR--------VLEAIASEKSV-------------RSDDKYDVFLKRIENYRKTIL 159
            KRI  R        +   I     V             R DDK +V  KR   Y +   
Sbjct: 121 VKRISNRRICSNCGKIYNLITLPPKVDGKCDVCGGTLYQREDDKEEVVRKRYRVYMENTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           P+  YY+    L+ ++G LD+D V + + +++
Sbjct: 181 PVIEYYQKSNKLFTVNGALDVDSVIKEVLNII 212


>gi|170077666|ref|YP_001734304.1| adenylate kinase [Synechococcus sp. PCC 7002]
 gi|169885335|gb|ACA99048.1| adenylate kinase [Synechococcus sp. PCC 7002]
          Length = 187

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 116/193 (60%), Gaps = 10/193 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+IFLGPPG+GKGTQA  L++   +P +STG++LRA +   T LG+Q +G ++ G L+ 
Sbjct: 5   VRLIFLGPPGAGKGTQAQVLAESCGIPHISTGEILRAAIANQTELGQQAQGFVDRGELVP 64

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+++  ++ +R++  D   G+ILDG+PR V QA+ L+  ++ +    D  + L V DA++
Sbjct: 65  DSLILNLIRERLQEQDAQQGWILDGFPRNVSQAEFLNTLLTELKQQCDVALNLEVPDATL 124

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R DD  +   +R+E YR+   P+  +Y+  G L  +DG   +
Sbjct: 125 VERLLSR----------GRKDDNQETIRRRLEVYREQTAPVIDFYQKQGSLKSVDGDRSL 174

Query: 181 DEVSRSIDSLLVS 193
           +EV+ +++  + S
Sbjct: 175 EEVTAALEQAIAS 187


>gi|289435877|ref|YP_003465749.1| adenylate kinase [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|315304922|ref|ZP_07875026.1| adenylate kinase [Listeria ivanovii FSL F6-596]
 gi|289172121|emb|CBH28667.1| adenylate kinase [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313626713|gb|EFR95742.1| adenylate kinase [Listeria ivanovii FSL F6-596]
 gi|313631795|gb|EFR98975.1| adenylate kinase [Listeria seeligeri FSL N1-067]
          Length = 215

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QAK L   +S++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAKELENILSDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +    R+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVAGKCDLDGGELYQREDDKKETVENRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHSINGEQDIKDVFVDVEKILAS 214


>gi|255994828|ref|ZP_05427963.1| adenylate kinase [Eubacterium saphenum ATCC 49989]
 gi|255993541|gb|EEU03630.1| adenylate kinase [Eubacterium saphenum ATCC 49989]
          Length = 212

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 25/212 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA R+ +K  VP +STGD+ R  +  NT LG++ +  M  G L+ 
Sbjct: 1   MNLILLGPPGAGKGTQATRIVEKYKVPHISTGDIFRENIKNNTPLGQKAQEYMNKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +  DR+   DC +GF+LDG+PRTV QA +L  F+ +    ID VI + VED  +
Sbjct: 61  DQLVVDIALDRLGKDDCKNGFLLDGFPRTVFQADALDKFLKDKGKGIDLVINIEVEDKML 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
            +R+   RV    A+  +V                    R DDK +    RI+ Y +   
Sbjct: 121 IERLDARRVCPTCAATYNVIGMPPKKEGICDKCNDTLIQRKDDKKETVGNRIKVYHEQTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLD----MDEVSRSI 187
           PL  YY++ G +   DGM+      DE+ ++I
Sbjct: 181 PLIDYYKEKGLIKDFDGMIGADALFDEIVKAI 212


>gi|77166298|ref|YP_344823.1| adenylate kinase [Nitrosococcus oceani ATCC 19707]
 gi|254435669|ref|ZP_05049176.1| adenylate kinases subfamily [Nitrosococcus oceani AFC27]
 gi|123593340|sp|Q3J7A3|KAD_NITOC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|76884612|gb|ABA59293.1| Adenylate kinase [Nitrosococcus oceani ATCC 19707]
 gi|207088780|gb|EDZ66052.1| adenylate kinases subfamily [Nitrosococcus oceani AFC27]
          Length = 217

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 117/217 (53%), Gaps = 22/217 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR + LG PGSGKGTQ  RLSQ+  +PQ+STGD+LRA V   + LGKQ K +M++G L+S
Sbjct: 1   MRAVLLGAPGSGKGTQGERLSQQYGIPQVSTGDLLRAAVAAGSELGKQAKAAMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+  PD   G+ILDG+PR   QA++L   ++ ++  + A+I L V    +
Sbjct: 61  DQIVIGIIRERLTQPDAAKGYILDGFPRNFTQAQALDEMLATLERPLQAIILLDVNFEVL 120

Query: 121 FKRIQVR--------VLEAIASEKSV--------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R        +     S   V              RSDD  +    R+  Y    
Sbjct: 121 MRRLTGRRTCQACGAIYNIYFSPPEVDHRCDKCNSDQLVQRSDDNEETISNRLRVYEAQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            PL  YY   G LY +DG  D+ +++++I  +L + R
Sbjct: 181 APLVDYYEAQGKLYKVDGEDDITKIAKNIGQILETAR 217


>gi|308235474|ref|ZP_07666211.1| adenylate kinase [Gardnerella vaginalis ATCC 14018]
 gi|311115146|ref|YP_003986367.1| adenylate kinase [Gardnerella vaginalis ATCC 14019]
 gi|310946640|gb|ADP39344.1| adenylate kinase [Gardnerella vaginalis ATCC 14019]
          Length = 186

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 107/192 (55%), Gaps = 6/192 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++   +P +STGD+ R  +   T LGK+V+G ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHYGIPAISTGDIFRYNLKNQTELGKKVQGYLDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  +G+ILDGYPR   Q K+L   +  +   +D V+ L  E   +
Sbjct: 61  DELTNSIVKDRLAQDDAKNGWILDGYPRNASQVKALDLMLEELGTPLDHVVALEAEREVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R +E        RSDD  +V   R+E Y K   PL   Y   G L  +DG+ D+
Sbjct: 121 LERMKKRAIE------QGRSDDTPEVIATRLETYEKETAPLLDIYESRGQLVEVDGVGDI 174

Query: 181 DEVSRSIDSLLV 192
            E++  I   LV
Sbjct: 175 AEINNRIVESLV 186


>gi|260891069|ref|ZP_05902332.1| adenylate kinase [Leptotrichia hofstadii F0254]
 gi|260859096|gb|EEX73596.1| adenylate kinase [Leptotrichia hofstadii F0254]
          Length = 209

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L QK  +PQ+STGD+LRA +   T LG + K  M+ G L+S
Sbjct: 1   MNIVLFGAPGAGKGTQAKELIQKYEIPQISTGDILRAAIANKTPLGLEAKKLMDEGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V  R++  DC  GFILDG+PRTV QA+ L   ++  +  I+ VI L V D  +
Sbjct: 61  DEIVNGLVEARLQEEDCKKGFILDGFPRTVAQAEELDKILAKSNREIEKVIALEVSDEEI 120

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                 ++    +   R+DD  +   KR+  Y +   P+  +
Sbjct: 121 IERITGRRVSKKTGKIYHIKYNPPVDENPEDLEQRADDNEETVKKRLAVYNEQTAPVLDF 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +Y +DG   ++E+++ I  +L
Sbjct: 181 YKKQNKVYSVDGAKKLEEITKDIIDIL 207


>gi|257126857|ref|YP_003164971.1| adenylate kinase [Leptotrichia buccalis C-1013-b]
 gi|257050796|gb|ACV39980.1| adenylate kinase [Leptotrichia buccalis C-1013-b]
          Length = 209

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L QK  +PQ+STGD+LRA +   T LG + K  M+ G L+S
Sbjct: 1   MNIVLFGAPGAGKGTQAKELIQKYEIPQISTGDILRAAIANKTPLGLEAKKLMDEGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V  R++  DC  GFILDG+PRTV QA+ L   ++  D  I+ VI L V D  +
Sbjct: 61  DDIVNGLVEARLQEEDCKKGFILDGFPRTVAQAEELDKILAKSDREIEKVIALDVSDEEI 120

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                 ++    +   R+DD  +   KR+  Y +   P+  +
Sbjct: 121 IERITGRRVSKKTGKIYHIKYNPPVDENPEDLEQRADDNEETVKKRLAVYNEQTAPVLDF 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +Y +DG   ++E+++ I  +L
Sbjct: 181 YKKQNKVYSVDGAKKLEEITKDIIDIL 207


>gi|312793919|ref|YP_004026842.1| adenylate kinase [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312877385|ref|ZP_07737350.1| adenylate kinase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795859|gb|EFR12223.1| adenylate kinase [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181059|gb|ADQ41229.1| adenylate kinase [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 215

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS++ ++P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEYLSKRFSIPHISTGDILRENVKNETELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V DRI   DC +GF+LDG+PRT+ QA++L   +  +   ID V+ + V D  +
Sbjct: 61  DEIVIEIVKDRISKEDCKNGFLLDGFPRTIAQAEALDKVLQELGQKIDKVLNIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKNCGASFHVIYRPPQKEGVCDVCGGELYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G L +  G  ++ + ++ +
Sbjct: 181 PLIDYYRAKGLLVVAYGQEEIADTTKEV 208


>gi|169830009|ref|YP_001700167.1| adenylate kinase [Lysinibacillus sphaericus C3-41]
 gi|226743887|sp|B1HMV9|KAD_LYSSC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|168994497|gb|ACA42037.1| Adenylate kinase [Lysinibacillus sphaericus C3-41]
          Length = 217

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 118/216 (54%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +G PG+GKGTQA ++ +K  +P +STGDM RA +   T LG Q K  M+ G+L+ 
Sbjct: 1   MNIVLMGLPGAGKGTQADKIVEKYAIPHISTGDMFRAAIKEGTELGLQAKSFMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC+ GF+LDG+PRTV QA++L + ++++  AI+  + ++VE   +
Sbjct: 61  DEVTIGIVRERLAKPDCEKGFLLDGFPRTVPQAEALDSILADLGKAIEHTLNIQVEKDEL 120

Query: 121 FKRIQVR------------VLEAIASEKS---------VRSDDKYDVFLKRIENYRKTIL 159
             R+  R            +    A E            R+DD  D    R+E   K   
Sbjct: 121 IARLSGRRICKTCGASYHLIFNPPAEEGKCDKDGGELYTRADDNPDTVANRLEVNMKQAQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y+  G L  IDG  D+++V   +D+LL S R
Sbjct: 181 PLLDFYQAKGVLTNIDGQQDINKVFADLDALLQSSR 216


>gi|329850229|ref|ZP_08265074.1| adenylate kinase [Asticcacaulis biprosthecum C19]
 gi|328840544|gb|EGF90115.1| adenylate kinase [Asticcacaulis biprosthecum C19]
          Length = 194

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 110/191 (57%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  GPP +GKGTQA RL     + QLSTGDMLRA +   + LG +VK  M++G L+S
Sbjct: 1   MNIILFGPPAAGKGTQAKRLVATRGMVQLSTGDMLRAAIASGSELGTRVKTIMDTGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV  ++ + +   +   G I DG+PRTV QA++L A +      ID V+ L+V++  +
Sbjct: 61  DAIVIDLIKENLPRAEAAGGAIFDGFPRTVAQAEALDAMLGGRGARIDKVVRLKVDEQGL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R       ++  R+DD  + +  R+  Y     PL  YY   G LY IDGM  +
Sbjct: 121 IERIATRF------QQEGRADDNPESYKVRLAAYNAQTAPLLPYYAAQGKLYEIDGMGAV 174

Query: 181 DEVSRSIDSLL 191
           D+++  ++ +L
Sbjct: 175 DDIAARVEEVL 185


>gi|313836050|gb|EFS73764.1| adenylate kinase [Propionibacterium acnes HL037PA2]
 gi|314929588|gb|EFS93419.1| adenylate kinase [Propionibacterium acnes HL044PA1]
 gi|314970527|gb|EFT14625.1| adenylate kinase [Propionibacterium acnes HL037PA3]
 gi|328906203|gb|EGG25978.1| adenylate kinase [Propionibacterium sp. P08]
          Length = 189

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 113/193 (58%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++   VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYCVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + +QVV DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDQVVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGRQLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R+  Y     PL  +YR +G    +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDNEETIRNRMSVYSSQTEPLLEHYRSVGIFVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|254412173|ref|ZP_05025948.1| adenylate kinases subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196181139|gb|EDX76128.1| adenylate kinases subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 184

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 112/192 (58%), Gaps = 10/192 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA  ++Q   +P +STGD+LR+ +  +T LG++ +  M+ G L+ D
Sbjct: 3   RLVFLGPPGAGKGTQAQHIAQLYQIPHISTGDILRSAITASTSLGQKAQSYMDGGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            ++  ++ DR++ PD  +G+ILDG+PR V QA  L   + ++D   D  I L V D S+ 
Sbjct: 63  KLILDLIRDRLKQPDTQAGWILDGFPRNVSQAAFLENLLQDLDQRCDYAIYLDVPDESIL 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+  R           R DD      +R++ YR+   P+  +YRD   L  IDG   M+
Sbjct: 123 KRLLSR----------GRQDDNEQTIRRRLDVYRQQTAPVIEFYRDHSILREIDGDRPME 172

Query: 182 EVSRSIDSLLVS 193
            V+ S+  ++ S
Sbjct: 173 AVTDSLKQVMSS 184


>gi|292490639|ref|YP_003526078.1| adenylate kinase [Nitrosococcus halophilus Nc4]
 gi|291579234|gb|ADE13691.1| adenylate kinase [Nitrosococcus halophilus Nc4]
          Length = 217

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 121/213 (56%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR + LG PGSGKGTQ   LSQK  +PQ+STGD+LRA V   + LGKQ K +M++G L+S
Sbjct: 1   MRTVLLGAPGSGKGTQGELLSQKYGIPQISTGDLLRAAVAAGSELGKQAKAAMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+  PD   G+ILDG+PR + QA++L   ++ ++  + AVI L V+   +
Sbjct: 61  DEIVIGIIRERLTQPDAAKGYILDGFPRNLAQAQALDEMLAALEQPLQAVILLDVDFEVL 120

Query: 121 FKRIQVR----VLEAI-----------------ASEKSV-RSDDKYDVFLKRIENYRKTI 158
            KR+  R    V  AI                  S++ + RSDD  +    R++ Y+   
Sbjct: 121 MKRLTGRRTCQVCGAIYNIYFSPPQEDQRCDKCGSDQLIQRSDDNEETIANRLQVYQSQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L+ ++G  ++ EV++ I  +L
Sbjct: 181 APLVDYYEAQGKLHKVNGTDEVTEVAKHIGQIL 213


>gi|313763210|gb|EFS34574.1| adenylate kinase [Propionibacterium acnes HL013PA1]
 gi|313816547|gb|EFS54261.1| adenylate kinase [Propionibacterium acnes HL059PA1]
 gi|314914359|gb|EFS78190.1| adenylate kinase [Propionibacterium acnes HL005PA4]
 gi|314917679|gb|EFS81510.1| adenylate kinase [Propionibacterium acnes HL050PA1]
 gi|314919589|gb|EFS83420.1| adenylate kinase [Propionibacterium acnes HL050PA3]
 gi|314930180|gb|EFS94011.1| adenylate kinase [Propionibacterium acnes HL067PA1]
 gi|314957148|gb|EFT01252.1| adenylate kinase [Propionibacterium acnes HL027PA1]
 gi|314957789|gb|EFT01892.1| adenylate kinase [Propionibacterium acnes HL002PA1]
 gi|315097958|gb|EFT69934.1| adenylate kinase [Propionibacterium acnes HL059PA2]
 gi|315100601|gb|EFT72577.1| adenylate kinase [Propionibacterium acnes HL046PA1]
 gi|327451448|gb|EGE98102.1| adenylate kinase [Propionibacterium acnes HL087PA3]
 gi|327451863|gb|EGE98517.1| adenylate kinase [Propionibacterium acnes HL083PA2]
 gi|328752077|gb|EGF65693.1| adenylate kinase [Propionibacterium acnes HL087PA1]
          Length = 189

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNATELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRADDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|94498497|ref|ZP_01305053.1| adenylate kinases [Sphingomonas sp. SKA58]
 gi|94422040|gb|EAT07085.1| adenylate kinases [Sphingomonas sp. SKA58]
          Length = 218

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 112/213 (52%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL   L + QLSTGDMLRA V   T +G + K  ME+G L+S
Sbjct: 1   MNIILLGPPGAGKGTQAARLVDNLGMVQLSTGDMLRAAVKAGTPIGLKAKAVMEAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ + +     ++G I DGYPRT  QA +L   +S+ D  +D VIEL V + ++
Sbjct: 61  DEIVSGIIGEALDALSPETGVIFDGYPRTEAQAHALDTILSDRDRTLDHVIELEVNEDAL 120

Query: 121 FKRIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R   A                         E   R DD  +    R+  YR   
Sbjct: 121 VDRITGRFTCATCGAGYHDRFKQPKVDGECDKCHGHEFKRRPDDNEETVRTRMAEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+   Y   G +  +DGM DMD+V+++I ++L
Sbjct: 181 APILPVYEARGIVSRVDGMADMDDVTKAIAAIL 213


>gi|294085979|ref|YP_003552739.1| adenylate kinase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665554|gb|ADE40655.1| adenylate kinase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 188

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II  G PG+GKGTQA RL  +  + QLSTGDMLR+ +   + LG + K  M+ G L+S
Sbjct: 1   MNIILFGAPGAGKGTQAERLVSERGMIQLSTGDMLRSAIASGSELGLRAKDIMDRGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R+   D  SG+ILDG+PRTV QA++L   +++    I  VIE++V++A++
Sbjct: 61  DDIMVGMIAERMDNDDSTSGYILDGFPRTVAQAEALDEMMASRGDEIAHVIEIKVDEAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
           F RI+ R  E+  +    RSDD  +    R+  Y +   PL  +Y+  G L  I+GM  +
Sbjct: 121 FARIENRAKESAGN----RSDDNAETLRNRLVVYHENTAPLLPFYQAKGKLRSINGMTSI 176

Query: 181 DEVSRSIDSLL 191
           ++VS  I+ +L
Sbjct: 177 EDVSSEINKIL 187


>gi|289427573|ref|ZP_06429285.1| adenylate kinase [Propionibacterium acnes J165]
 gi|295131360|ref|YP_003582023.1| Adenylate kinase [Propionibacterium acnes SK137]
 gi|289159064|gb|EFD07256.1| adenylate kinase [Propionibacterium acnes J165]
 gi|291376893|gb|ADE00748.1| Adenylate kinase [Propionibacterium acnes SK137]
 gi|313773125|gb|EFS39091.1| adenylate kinase [Propionibacterium acnes HL074PA1]
 gi|313808812|gb|EFS47266.1| adenylate kinase [Propionibacterium acnes HL087PA2]
 gi|313810394|gb|EFS48108.1| adenylate kinase [Propionibacterium acnes HL083PA1]
 gi|313812270|gb|EFS49984.1| adenylate kinase [Propionibacterium acnes HL025PA1]
 gi|313817991|gb|EFS55705.1| adenylate kinase [Propionibacterium acnes HL046PA2]
 gi|313819905|gb|EFS57619.1| adenylate kinase [Propionibacterium acnes HL036PA1]
 gi|313823395|gb|EFS61109.1| adenylate kinase [Propionibacterium acnes HL036PA2]
 gi|313824867|gb|EFS62581.1| adenylate kinase [Propionibacterium acnes HL063PA1]
 gi|313830108|gb|EFS67822.1| adenylate kinase [Propionibacterium acnes HL007PA1]
 gi|313832620|gb|EFS70334.1| adenylate kinase [Propionibacterium acnes HL056PA1]
 gi|314924154|gb|EFS87985.1| adenylate kinase [Propionibacterium acnes HL001PA1]
 gi|314925761|gb|EFS89592.1| adenylate kinase [Propionibacterium acnes HL036PA3]
 gi|314960841|gb|EFT04942.1| adenylate kinase [Propionibacterium acnes HL002PA2]
 gi|314964884|gb|EFT08983.1| adenylate kinase [Propionibacterium acnes HL082PA2]
 gi|314973043|gb|EFT17139.1| adenylate kinase [Propionibacterium acnes HL053PA1]
 gi|314975539|gb|EFT19634.1| adenylate kinase [Propionibacterium acnes HL045PA1]
 gi|314979772|gb|EFT23866.1| adenylate kinase [Propionibacterium acnes HL072PA2]
 gi|314984823|gb|EFT28915.1| adenylate kinase [Propionibacterium acnes HL005PA1]
 gi|314988696|gb|EFT32787.1| adenylate kinase [Propionibacterium acnes HL005PA3]
 gi|315079823|gb|EFT51799.1| adenylate kinase [Propionibacterium acnes HL078PA1]
 gi|315083190|gb|EFT55166.1| adenylate kinase [Propionibacterium acnes HL027PA2]
 gi|315086856|gb|EFT58832.1| adenylate kinase [Propionibacterium acnes HL002PA3]
 gi|315089948|gb|EFT61924.1| adenylate kinase [Propionibacterium acnes HL072PA1]
 gi|315093703|gb|EFT65679.1| adenylate kinase [Propionibacterium acnes HL060PA1]
 gi|315096730|gb|EFT68706.1| adenylate kinase [Propionibacterium acnes HL038PA1]
 gi|315103995|gb|EFT75971.1| adenylate kinase [Propionibacterium acnes HL050PA2]
 gi|327325144|gb|EGE66950.1| adenylate kinase [Propionibacterium acnes HL096PA3]
 gi|327325227|gb|EGE67032.1| adenylate kinase [Propionibacterium acnes HL096PA2]
 gi|327325522|gb|EGE67321.1| adenylate kinase [Propionibacterium acnes HL103PA1]
 gi|327444027|gb|EGE90681.1| adenylate kinase [Propionibacterium acnes HL043PA1]
 gi|327449345|gb|EGE95999.1| adenylate kinase [Propionibacterium acnes HL013PA2]
 gi|327449427|gb|EGE96081.1| adenylate kinase [Propionibacterium acnes HL043PA2]
 gi|328756310|gb|EGF69926.1| adenylate kinase [Propionibacterium acnes HL020PA1]
 gi|328761356|gb|EGF74883.1| adenylate kinase [Propionibacterium acnes HL099PA1]
          Length = 189

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 113/193 (58%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++   VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYRVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|315109204|gb|EFT81180.1| adenylate kinase [Propionibacterium acnes HL030PA2]
          Length = 189

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 114/193 (59%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M+ G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNGTELGKKVKAIMDVGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  ++   R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRADDNEEIIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|170758509|ref|YP_001788800.1| adenylate kinase [Clostridium botulinum A3 str. Loch Maree]
 gi|226741867|sp|B1KSK4|KAD_CLOBM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|169405498|gb|ACA53909.1| adenylate kinase [Clostridium botulinum A3 str. Loch Maree]
          Length = 216

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ RA +   T LG + K  M++G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAKLISEKFSIPHISTGDIFRANIKEKTPLGIEAKRYMDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKELDVALLIKVPEEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   +DEV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESIDEVFGNISNIL 212


>gi|89893238|ref|YP_516725.1| adenylate kinase [Desulfitobacterium hafniense Y51]
 gi|219666511|ref|YP_002456946.1| adenylate kinase [Desulfitobacterium hafniense DCB-2]
 gi|122483918|sp|Q250L1|KAD_DESHY RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806986|sp|B8G1Y7|KAD_DESHD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|89332686|dbj|BAE82281.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536771|gb|ACL18510.1| Adenylate kinase [Desulfitobacterium hafniense DCB-2]
          Length = 217

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR I +GPPG+GKGTQA  L  +  +P +STGDM RA +   T LG + K  M++GSL+ 
Sbjct: 1   MRAILMGPPGAGKGTQAADLITRYQIPHISTGDMFRAAIKAGTALGMKAKEYMDAGSLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC  GF+LDG+PRTV QA +L   ++ +   +D VI + V +A +
Sbjct: 61  DEVTIGIVAERLAEPDCSKGFLLDGFPRTVAQADALDKILTQLKMNLDGVINIEVPEAKL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   RSDD  +    R++ Y     
Sbjct: 121 LERLTGRRICRQCGGTYHMVFNPPAAEAVCDKCGGELYQRSDDTLETAKNRLQVYNDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR+ G L  I+G  D+ +V + I
Sbjct: 181 PLIDYYREKGLLKEINGDQDIAQVLQDI 208


>gi|195151257|ref|XP_002016564.1| GL11651 [Drosophila persimilis]
 gi|194110411|gb|EDW32454.1| GL11651 [Drosophila persimilis]
          Length = 222

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 116/213 (54%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 4   ILLGPPGSGKGTQAPLLKEKYCVCHLSTGDMLRAEISSGSKLGTELKKVMDAGKLVSDEL 63

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L + +      +DAVIE  ++D+ + +R
Sbjct: 64  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDSLLDKRKANLDAVIEFAIDDSLLVRR 123

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E+Y K   PL 
Sbjct: 124 ITGRLIHQASGRSYHEEFAPPKVTMKDDITGEPLMRRSDDNAEALKKRLESYHKQTRPLV 183

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  Y +D      +V  +I+S+    R
Sbjct: 184 DYYGLRGLHYKVDAARKSSDVFSTIESIFQRQR 216


>gi|332187859|ref|ZP_08389593.1| adenylate kinases family protein [Sphingomonas sp. S17]
 gi|332012209|gb|EGI54280.1| adenylate kinases family protein [Sphingomonas sp. S17]
          Length = 215

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 114/213 (53%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +G Q K  M++G L+S
Sbjct: 1   MNIILLGPPGAGKGTQAQRLVANRGMVQLSTGDMLRAAVKAGTPVGLQAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DAIV+ ++ +R+   D + G I DGYPRT  QA++L   +S     +D VIEL V++ ++
Sbjct: 61  DAIVSALIGERLDQADAEGGAIFDGYPRTEAQAEALDLLLSERGKTLDHVIELAVDEDAL 120

Query: 121 FKRIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
            +RI  R                  +E +     ++E   R DD  +    R+  YR   
Sbjct: 121 VERITGRFTCASCGAGYHDTFKPTQVEGVCDVCGSTEFKRRPDDNAETVRTRMAEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+   Y   G +  +DGM  MD V   ID++L
Sbjct: 181 APILPIYEARGIVTRVDGMAAMDAVGAEIDAIL 213


>gi|198458025|ref|XP_001360879.2| GA16231 [Drosophila pseudoobscura pseudoobscura]
 gi|224493079|sp|Q290A8|KAD2_DROPS RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|198136195|gb|EAL25454.2| GA16231 [Drosophila pseudoobscura pseudoobscura]
          Length = 240

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 116/213 (54%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKYCVCHLSTGDMLRAEISSGSKLGTELKKVMDAGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L + +      +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDSLLDKRKANLDAVIEFAIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E+Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKVTMKDDITGEPLMRRSDDNAEALKKRLESYHKQTRPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  Y +D      +V  +I+S+    R
Sbjct: 202 DYYGLRGLHYKVDAARKSSDVFSTIESIFQRQR 234


>gi|297242949|ref|ZP_06926887.1| adenylate kinase [Gardnerella vaginalis AMD]
 gi|296889160|gb|EFH27894.1| adenylate kinase [Gardnerella vaginalis AMD]
          Length = 181

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 103/182 (56%), Gaps = 6/182 (3%)

Query: 6   LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVN 65
           +GP G GKGTQA  LS+   +P +STGD+ R  +  +T LGKQV+G ++ G L+ D + N
Sbjct: 1   MGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNLKNHTELGKQVQGYLDKGELVPDELTN 60

Query: 66  QVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ 125
            +V DR+   D  SG+ILDGYPR   Q ++L   +  +   +D V+ L  E   + +R+Q
Sbjct: 61  NIVKDRLAQDDAKSGWILDGYPRNASQVQALDRMLEELGTPLDHVVALEAERDVLLERMQ 120

Query: 126 VRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            R +E        RSDD  +V  KR+E Y K   PL   Y   G L  +DG+ D+ E++ 
Sbjct: 121 KRAVE------QGRSDDTPEVIAKRLETYEKETAPLLDIYDSRGQLVEVDGVGDIKEINN 174

Query: 186 SI 187
            I
Sbjct: 175 RI 176


>gi|21232720|ref|NP_638637.1| adenylate kinase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66767205|ref|YP_241967.1| adenylate kinase [Xanthomonas campestris pv. campestris str. 8004]
 gi|24418464|sp|Q8P5P5|KAD_XANCP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|81306812|sp|Q4UYC6|KAD_XANC8 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|21114533|gb|AAM42561.1| adenylate kinase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572537|gb|AAY47947.1| adenylate kinase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 187

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 109/191 (57%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAARLKDTFQIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D  +GFILDGYPR V QA +L + +S +   +DAV++L V    +
Sbjct: 61  DEILLGMLEARLGQADVANGFILDGYPRNVAQANALDSLLSKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV   I   L
Sbjct: 175 DEVLERIGQAL 185


>gi|289739711|gb|ADD18603.1| adenylate kinase [Glossina morsitans morsitans]
          Length = 247

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 116/213 (54%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG  +K  M+ G L+SD +
Sbjct: 32  VLLGPPGSGKGTQAPWLKEKFCVCHLSTGDMLRAEISSGSQLGATLKKVMDDGKLVSDEL 91

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   ++    ++DAVIE  ++D  + +R
Sbjct: 92  VVGMIDKNLDKPECKNGFLLDGFPRTVVQAQKLDELLAKRKTSLDAVIEFAIDDNLLVRR 151

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+++Y K   PL 
Sbjct: 152 ITGRLIHPSSGRSYHEEFAPPKIAMTDDVTGEPLIRRSDDNAEALKKRLDSYHKQTKPLV 211

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +IDS+ +S R
Sbjct: 212 DYYALRGLHFRVDAAKKASDVFANIDSIFLSRR 244


>gi|83858545|ref|ZP_00952067.1| adenylate kinase, putative [Oceanicaulis alexandrii HTCC2633]
 gi|83853368|gb|EAP91220.1| adenylate kinase, putative [Oceanicaulis alexandrii HTCC2633]
          Length = 187

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 108/191 (56%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  GPPG+GKGTQA RL       QLSTGDMLRA +     LG++VK  M+ G L+S
Sbjct: 1   MNLVLFGPPGAGKGTQAKRLVADYGWLQLSTGDMLRAAIAAGNELGRKVKDIMDRGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+   +   G I DG+PRTV QA++L   +++    ID V+ L V+   +
Sbjct: 61  DEIVIALIEERLPEAEIAGGAIFDGFPRTVAQAEALDELLASRSTQIDKVVRLVVDQDEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R      + +  R+DD  + F  R+ENY     PL  YY   G L  +DGM  M
Sbjct: 121 VSRMEKR------AAQEGRADDTVEAFKVRLENYNAQTAPLIPYYEGQGKLSDVDGMGQM 174

Query: 181 DEVSRSIDSLL 191
           DEV+  I + L
Sbjct: 175 DEVAARIAAAL 185


>gi|322691849|ref|YP_004221419.1| adenylate kinase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320456705|dbj|BAJ67327.1| adenylate kinase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 186

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++  N+P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHFNIPTISTGDIFRYNIKNKTELGLEAMSYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V DR+   DC +G+ILDGYPR   Q  +L   ++++D  +D V+ L      +
Sbjct: 61  DSLTNKIVKDRLAKEDCKNGWILDGYPRNAAQVIALDEMLADLDTPLDHVVALEAARDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R     A+E+  R+DD  +   KR+E Y K   PL   Y   G L +++G+ D+
Sbjct: 121 LERMKKR-----AAEQG-RADDTPEAIAKRLETYEKETAPLLDIYEARGLLVVVNGVGDI 174

Query: 181 DEVSRSIDSLL 191
           DE+S  I S L
Sbjct: 175 DEISGRIISHL 185


>gi|331699155|ref|YP_004335394.1| adenylate kinase [Pseudonocardia dioxanivorans CB1190]
 gi|326953844|gb|AEA27541.1| Adenylate kinase [Pseudonocardia dioxanivorans CB1190]
          Length = 182

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 111/184 (60%), Gaps = 12/184 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA R++++L +P +STGD+ RA +   T LG + KG M++G+L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAVRIAEQLGIPHISTGDLFRANLAGETPLGLEAKGYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V  R+  PD   GF+LDG+PRT  QA +L   ++     +DAV+EL+V +  +
Sbjct: 61  DSVTVGMVKARLADPDAAKGFLLDGFPRTTAQADALAEILAETGDELDAVVELQVPEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           RSDD  DV   R + YR    PL  YYRD   L  +D + ++
Sbjct: 121 VERLLAR----------GRSDDTEDVIRNRQQVYRDETAPLLDYYRDR--LVTVDAVGEV 168

Query: 181 DEVS 184
            E++
Sbjct: 169 AEIT 172


>gi|268609572|ref|ZP_06143299.1| adenylate kinase [Ruminococcus flavefaciens FD-1]
          Length = 212

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 116/206 (56%), Gaps = 25/206 (12%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLG PG+GKGTQA  +S +LN+PQ+STG++LR      T  G + K +M++G+L+S
Sbjct: 1   MNLIFLGAPGAGKGTQAEVVSDELNIPQISTGNILREAAKNGTEYGLKAKAAMDAGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +RI   DC +GFILDG+PRTV QA++L A    M   ID VIE+ V D ++
Sbjct: 61  DDIVIGILKERIAEDDCKNGFILDGFPRTVPQAEALDA----MGIKIDKVIEIHVPDETI 116

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    +  VR DD+ +V L R+  Y +   
Sbjct: 117 KQRVSGRRVCQGCGASYHIQYKPTKVEGICDKCGDKTIVRKDDQPEVVLDRLATYHEKTA 176

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSR 185
           PL  YY   G L  ++G  ++ + S+
Sbjct: 177 PLKGYYEKQGKLVTVEGQEEVADTSK 202


>gi|314982281|gb|EFT26374.1| adenylate kinase [Propionibacterium acnes HL110PA3]
 gi|315090468|gb|EFT62444.1| adenylate kinase [Propionibacterium acnes HL110PA4]
          Length = 189

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 113/193 (58%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++   VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYRVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      +DAVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLDAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDSEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|330803790|ref|XP_003289885.1| adenylate kinase [Dictyostelium purpureum]
 gi|325079996|gb|EGC33570.1| adenylate kinase [Dictyostelium purpureum]
          Length = 271

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 119/215 (55%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ +GPPGSGKGTQA  + +   +  L+TGDMLRA +++ T  GKQ K  M+ G L+ 
Sbjct: 21  LRVVLIGPPGSGKGTQAPIIKEDYCLCHLATGDMLRAAIEQGTETGKQAKTIMDQGGLVP 80

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ + I+ P+C  GFILDG+PRTV QA+ L   +S  +  ID V++  ++D+ +
Sbjct: 81  DEVMVNMIKENIQNPECKKGFILDGFPRTVPQAEKLDKMLSEDNKKIDHVLDFSIDDSLL 140

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      +  E  + RSDD  +V  KR+E++ K   
Sbjct: 141 VRRITGRLVHLPSGRSYHREFFPPKTEMVDDVTGEPLIQRSDDNAEVLKKRLESFHKNTK 200

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           P+  YY + G L  ID       VS +I S+ +S 
Sbjct: 201 PVLGYYHNKGILSTIDASQSASIVSSTIKSIFLST 235


>gi|39997928|ref|NP_953879.1| adenylate kinase [Geobacter sulfurreducens PCA]
 gi|68568784|sp|Q749A8|KAD_GEOSL RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|39984873|gb|AAR36229.1| adenylate kinase [Geobacter sulfurreducens PCA]
 gi|298506867|gb|ADI85590.1| adenylate kinase [Geobacter sulfurreducens KN400]
          Length = 217

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 117/214 (54%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++FLGPPG+GKGTQA  L++   VPQ+STG++LRA V   T +G + K  M+ G+L+ 
Sbjct: 1   MNLVFLGPPGAGKGTQANLLTRTYEVPQISTGEILRAAVKSKTPMGVKAKEYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++V  +V +R+  PDC SGFILDG+PRTV QA +L   +  +   I+ V+   V+   +
Sbjct: 61  DSVVVGIVEERLASPDCASGFILDGFPRTVAQADALKQVLGALGKQIEHVVSFEVDKGVL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +A   E   R DD+ D   +R+E Y +   
Sbjct: 121 LERIVGRRVCRACGRAFHVKFDPPLVDGVCDACGGELYQRDDDREDTMRRRLEVYDEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL SYY     L  ++ +  +++V R I  L+ S
Sbjct: 181 PLKSYYEGERLLRKVNALEPIEDVQRQIVKLVES 214


>gi|289662109|ref|ZP_06483690.1| adenylate kinase [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289668053|ref|ZP_06489128.1| adenylate kinase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 187

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 107/183 (58%), Gaps = 6/183 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFEIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D  +GFILDGYPR V QA +L A +S +   +DAV++L V    +
Sbjct: 61  DDILLGMLEARLGQADVANGFILDGYPRNVAQANALDALLSEIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEV 183
           DEV
Sbjct: 175 DEV 177


>gi|78211909|ref|YP_380688.1| adenylate kinase [Synechococcus sp. CC9605]
 gi|78196368|gb|ABB34133.1| adenylate kinases [Synechococcus sp. CC9605]
          Length = 183

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 115/190 (60%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL    ++  LSTGD+LR+EV   + LGK+ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCDANSMKHLSTGDLLRSEVAAGSDLGKEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  +++    D G++LDG+PRTV QA++L   ++ +   I AV+ L ++DA + 
Sbjct: 64  ALVLAIVESQMKALTTD-GWLLDGFPRTVPQAEALEPLLAELQQPIQAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R+DD   V   R+E YR+   PL  +Y D G L  +     ++
Sbjct: 123 ERLLAR----------CRADDNEAVIRNRLEVYREKTSPLIRFYSDKGLLVSVPAQGTVE 172

Query: 182 EVSRSIDSLL 191
           E+++ IDS+L
Sbjct: 173 EITKRIDSIL 182


>gi|302388067|ref|YP_003823889.1| adenylate kinase [Clostridium saccharolyticum WM1]
 gi|302198695|gb|ADL06266.1| adenylate kinase [Clostridium saccharolyticum WM1]
          Length = 214

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA ++++K  +P +STGD+ R+ +   T LG++ K  M+ G+L+ 
Sbjct: 1   MRIIMLGAPGAGKGTQAKKIAEKYQIPHISTGDIFRSNIKEGTELGRKAKEYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRIR  DC  G++LDG+PRT+ QA+SL   +S M+  ID  I + V D  +
Sbjct: 61  DELTIGMLMDRIRKGDCAKGYVLDGFPRTIPQAESLKKALSEMEQKIDFAINVDVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +   +   +R+DDK +   KR+  Y     
Sbjct: 121 IDRMAGRRACIACGATYHIVYNPSRVPDVCDVCGAGLVLRNDDKPETVKKRLSVYHDQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++ G L  IDG  ++++V   I  LL
Sbjct: 181 PLIDYYKEAGVLVNIDGTQELNKVFSDIADLL 212


>gi|302543340|ref|ZP_07295682.1| adenylate kinase [Streptomyces hygroscopicus ATCC 53653]
 gi|302460958|gb|EFL24051.1| adenylate kinase [Streptomyces himastatinicus ATCC 53653]
          Length = 218

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 113/207 (54%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGKQ +  M +G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQATYLAKNLSIPHISTGDLFRANISQGTPLGKQAQEYMRAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  +GF+LDG+PR V QA++L A++   +  +DAV++L V +  +
Sbjct: 61  DEVTVGMAEDRMSQPDAANGFLLDGFPRNVAQAQALDAYLRENELTLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y +  
Sbjct: 121 VKRIAGRRTCRNDSAHTFHVEYKKPETEGVCDVCGGELYQREDDSEETVRKRLEVYHRET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YY+  G +  I  +  + EV++
Sbjct: 181 EPIIDYYKAKGQVVTIPALGKVSEVTQ 207


>gi|195341784|ref|XP_002037485.1| GM18289 [Drosophila sechellia]
 gi|195347331|ref|XP_002040207.1| GM16084 [Drosophila sechellia]
 gi|195586291|ref|XP_002082911.1| GD11825 [Drosophila simulans]
 gi|224493083|sp|B4I2A8|KAD2_DROSE RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|224493084|sp|B4QBH8|KAD2_DROSI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|194132335|gb|EDW53903.1| GM18289 [Drosophila sechellia]
 gi|194135556|gb|EDW57072.1| GM16084 [Drosophila sechellia]
 gi|194194920|gb|EDX08496.1| GD11825 [Drosophila simulans]
          Length = 240

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 114/213 (53%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +IDS+    R
Sbjct: 202 DYYGLRGLHFKVDAAKKSSDVFSTIDSIFQRKR 234


>gi|290891796|ref|ZP_06554793.1| adk [Listeria monocytogenes FSL J2-071]
 gi|290558390|gb|EFD91907.1| adk [Listeria monocytogenes FSL J2-071]
          Length = 215

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 119/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LG++ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGRKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QA+ L   +S++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLSEDDAKNGFLLDGFPRTVEQAQELENILSDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVAGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILTS 214


>gi|166713310|ref|ZP_02244517.1| adenylate kinase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 187

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 107/183 (58%), Gaps = 6/183 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL    ++P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFDIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA +L A +S +   +DAV++L V    +
Sbjct: 61  DDILLGMLEARLGQADVAKGFILDGYPRNVAQANALDALLSKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLTRVDGVGSL 174

Query: 181 DEV 183
           DEV
Sbjct: 175 DEV 177


>gi|227494566|ref|ZP_03924882.1| adenylate kinase [Actinomyces coleocanis DSM 15436]
 gi|226832300|gb|EEH64683.1| adenylate kinase [Actinomyces coleocanis DSM 15436]
          Length = 201

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 109/190 (57%), Gaps = 6/190 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ LG PG+GKGTQA R++Q LNVP +STG + R  +   T LGK+    +  G  + D+
Sbjct: 11  VLILGAPGAGKGTQAERIAQFLNVPSISTGAIFRQNIKEETELGKRANEFISKGEFVPDS 70

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N +V  R+  PD D+G +LDGYPRTV+QA  L   +++    ID V+E+      +  
Sbjct: 71  VTNPMVAARLEAPDVDNGCLLDGYPRTVEQAHYLRDALASKGKEIDLVLEIVTNQEEVIA 130

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      +E   R+DD  +V   R+E YR+   P+++YY D   L  +DGM  +DE
Sbjct: 131 RLLKR------AEIEHRADDNEEVIRHRMEVYREMTEPMATYYADQDKLVQVDGMGTIDE 184

Query: 183 VSRSIDSLLV 192
           V   I+  L+
Sbjct: 185 VWARIEKALL 194


>gi|238922850|ref|YP_002936363.1| nucleoside-triphosphate--adenylate kinase [Eubacterium rectale ATCC
           33656]
 gi|259494002|sp|C4ZBT9|KAD_EUBR3 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238874522|gb|ACR74229.1| nucleoside-triphosphate--adenylate kinase [Eubacterium rectale ATCC
           33656]
 gi|291523751|emb|CBK89338.1| Adenylate kinase [Eubacterium rectale DSM 17629]
 gi|291528783|emb|CBK94369.1| Adenylate kinase [Eubacterium rectale M104/1]
          Length = 214

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K ++P +STGD+ RA +   T LGK+ K  M+ G+L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIAAKYSIPHISTGDIFRANIKNGTELGKKAKTYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  DC +GF+LDG+PRT+ QAK+L   ++ +   +D  I++ V D ++
Sbjct: 61  DELTCDLVMDRIQQDDCKNGFVLDGFPRTIPQAKALDDALTKIGEKMDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +A  ++  +R DDK +   KR+  Y +   
Sbjct: 121 VNRMGGRRACLNCGATYHIVFNPTKVEGKCDACGADTVLRDDDKPETVQKRLAVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG   MDEV  +I  +L
Sbjct: 181 PLIEYYDKQGILKSVDGTKPMDEVFSAIVGIL 212


>gi|239618244|ref|YP_002941566.1| adenylate kinase [Kosmotoga olearia TBF 19.5.1]
 gi|259494009|sp|C5CGI1|KAD_KOSOT RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|239507075|gb|ACR80562.1| adenylate kinase [Kosmotoga olearia TBF 19.5.1]
          Length = 215

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 115/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +++ +  +P +STGDMLR  V   T LGK+VK  +E G L+ 
Sbjct: 1   MNIILLGPPGAGKGTQAKKIAMRYGIPHISTGDMLREAVAAGTELGKKVKEIIEKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V DR++ PD   GFILDG+PRTV QA+SL   + N+   +DAVI +   +  +
Sbjct: 61  DDLMVAIVEDRLKKPDSAKGFILDGFPRTVQQAESLSGILGNLGKELDAVILIDAPEEVV 120

Query: 121 FKRI----------QVRVLEAIASEKSV-----------RSDDKYDVFLKRIENYRKTIL 159
            +RI          +V  L  I  +  +           R DDK     +R   Y +   
Sbjct: 121 VERISSRRVCPSCGKVYNLLTIKPKNDMLCDDCNIGLIQREDDKPATVRERYRVYMEKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           P+ +YY + G L  IDG LD++ V+  I
Sbjct: 181 PVINYYSEHGSLITIDGSLDIEAVTEEI 208


>gi|291461226|ref|ZP_06027715.2| adenylate kinase [Fusobacterium periodonticum ATCC 33693]
 gi|291378189|gb|EFE85707.1| adenylate kinase [Fusobacterium periodonticum ATCC 33693]
          Length = 211

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 115/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   MNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANQTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V DA +
Sbjct: 64  DEVVNGLVEERLAEKDCEKGFIMDGFPRTVVQAKALDEILTRLGKQIEKVIALNVPDADI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKEEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKGQNKVTEIDGTKKLEDITQDIYKIL 210


>gi|283796536|ref|ZP_06345689.1| adenylate kinase [Clostridium sp. M62/1]
 gi|291075950|gb|EFE13314.1| adenylate kinase [Clostridium sp. M62/1]
 gi|295115259|emb|CBL36106.1| Adenylate kinase [butyrate-producing bacterium SM4/1]
          Length = 213

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K  +P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYGIPHISTGDIFRANIKEGTELGMKAKEFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI+  DC +G++LDG+PRT+ QA+SL   +  M   ID  +++ V D ++
Sbjct: 61  DEVTIGMLLDRIKKEDCVNGYVLDGFPRTIPQAESLTKALEEMGQKIDYAVDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   +E  +R DDK +   KR+  Y +   
Sbjct: 121 VSRMSGRRACITCGATYHVQFAPPKAEGICDKCGAELVLRDDDKPETVQKRLAVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G L  +DG   MD+V  SI
Sbjct: 181 PLIDYYRRAGVLVSVDGTQSMDQVFESI 208


>gi|295092565|emb|CBK78672.1| Adenylate kinase [Clostridium cf. saccharolyticum K10]
          Length = 213

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA R+++K  +P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKRIAEKYGIPHISTGDIFRANIKEGTELGMKAKEFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI+  DC +G++LDG+PRT+ QA+SL   +  M   ID  +++ V D ++
Sbjct: 61  DEVTIGMLLDRIKKEDCVNGYVLDGFPRTIPQAESLTKALEEMGQKIDYAVDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   +E  +R DDK +   KR+  Y +   
Sbjct: 121 VSRMSGRRACITCGATYHVQFAPPKAEGICDKCGAELVLRDDDKPETVQKRLTVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G L  +DG   MD+V  SI
Sbjct: 181 PLIDYYRRAGVLVSVDGTQSMDQVFESI 208


>gi|297625809|ref|YP_003687572.1| Adenylate kinase [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921574|emb|CBL56128.1| Adenylate kinase (EC 2.7.4.3) (ATP-AMP transphosphorylase)
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 191

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 103/187 (55%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  ++    VP +STGDM R  V   T LGKQV   M++G  + 
Sbjct: 1   MRLLIMGAPGAGKGTQAVGIATHYGVPAISTGDMFRDNVKNGTPLGKQVDAIMKAGDFVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  Q+V DR+  PD   GF+LDG+PRT+ Q  +L  ++     ++DAVI L V+   +
Sbjct: 61  DELTEQIVADRLDQPDAQGGFLLDGFPRTMHQVDALDDYLDKHGHSLDAVISLDVDPEDL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      +E   R+DD  +    R+E Y  +  PL   Y+  G L  +DG   +
Sbjct: 121 IARLLKR------AELEGRADDNEETIRHRMEVYTSSTAPLLDAYKSRGLLVAVDGNGTV 174

Query: 181 DEVSRSI 187
           DEV   I
Sbjct: 175 DEVGARI 181


>gi|302379800|ref|ZP_07268284.1| adenylate kinase [Finegoldia magna ACS-171-V-Col3]
 gi|302312388|gb|EFK94385.1| adenylate kinase [Finegoldia magna ACS-171-V-Col3]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 115/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ ++ ++P +STGD+ R  +   T LG++V+G +  G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAKRVIEEFDIPHISTGDIFRKNIKEKTELGQKVEGLLAQGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GF+LDG+PRT+ QA++L   ++     +D V+ + V+  S+
Sbjct: 61  DELTIEIVWDRLDQEDCKNGFLLDGFPRTIPQAEALDEGLAKRGLKLDRVLNIDVDKDSL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + +A  +    R DDK +  L RI+ Y     
Sbjct: 121 VKRLSGRRVCPSCGASYHIDNNPTKVDGICDACQTPVIQREDDKEETVLDRIKVYDSQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     +Y +DG L +DE++  +
Sbjct: 181 PLVDFYNKQDLVYTVDGTLPIDEITNKL 208


>gi|227499174|ref|ZP_03929309.1| adenylate kinase [Acidaminococcus sp. D21]
 gi|226904621|gb|EEH90539.1| adenylate kinase [Acidaminococcus sp. D21]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 108/204 (52%), Gaps = 21/204 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA +L     +P +STGDM RA V   T LGK+ K  M++G L+ 
Sbjct: 1   MHILLMGPPGAGKGTQAEKLVADFPIPHISTGDMFRAAVKNGTELGKEAKKYMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC  GFILDG+PRT +QA +L   + ++   +DA + + V DA +
Sbjct: 61  DEVTIGIVRERLSQPDCVKGFILDGFPRTKEQAAALDDILKDLKIELDAAVNIAVPDADL 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   R+ +A  +   V                    R DDK     KR+E Y     
Sbjct: 121 VSRVTGRRICKACGATFHVTFNPPKKENVCDKCGGSLYQRDDDKETTVKKRLEAYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEV 183
           PL +YY+  G    IDG   +D+V
Sbjct: 181 PLIAYYKAAGVYKEIDGTQPIDKV 204


>gi|254459122|ref|ZP_05072544.1| adenylate kinase [Campylobacterales bacterium GD 1]
 gi|207084015|gb|EDZ61305.1| adenylate kinase [Campylobacterales bacterium GD 1]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 121/219 (55%), Gaps = 33/219 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L++K N+PQ+STGDMLRA +   T +GK  K +M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFLTKKFNIPQISTGDMLRAAIKAGTDMGKMAKAAMDAGQLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DRI   DC +G++LDG+PRT+ QA +    ++     IDAVIE+ V D+ +
Sbjct: 61  DEIIIGLVKDRIAEDDCKNGYLLDGFPRTLPQADA----VTQAGIVIDAVIEIDVPDSEI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             R+  R    +AS ++                       R DDK +V   R++ Y +  
Sbjct: 117 VNRMSGRRAH-LASGRTYHVTFNPPKVEGKDDETGEDLVQRDDDKAEVVADRLKVYHELT 175

Query: 159 LPLSSYYRDMGC-----LYI-IDGMLDMDEVSRSIDSLL 191
            PL  YY+D         YI +DG   + EV  +I + L
Sbjct: 176 QPLIGYYKDQSTTIDTLTYITVDGTAHISEVEAAITAEL 214


>gi|159904200|ref|YP_001551544.1| adenylate kinase [Prochlorococcus marinus str. MIT 9211]
 gi|238687120|sp|A9BCM8|KAD_PROM4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|159889376|gb|ABX09590.1| Adenylate kinase [Prochlorococcus marinus str. MIT 9211]
          Length = 186

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 113/190 (59%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA  L +   +  LSTGD+LRAEV+  + LGK+    M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAKLLCENQGLIHLSTGDLLRAEVNAQSPLGKEAALIMNKGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            IV  +V  R+   D  SG++LDG+PR + QA+SL   + N+   I AV+ + ++D ++ 
Sbjct: 64  EIVLSIVQKRLS-ADAKSGWLLDGFPRNLIQAQSLQQLLENVSQPIQAVLLIELDDETLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+  R           RSDD  +V   R+E YR+   PL  +Y+ +G L  I G  D+ 
Sbjct: 123 KRLLSR----------GRSDDTQEVIRHRLEVYREKTAPLVDFYQSLGILVKIQGEGDVK 172

Query: 182 EVSRSIDSLL 191
           +V+ +I S L
Sbjct: 173 DVALTIRSAL 182


>gi|257069486|ref|YP_003155741.1| Adenylate kinase [Brachybacterium faecium DSM 4810]
 gi|256560304|gb|ACU86151.1| Adenylate kinase [Brachybacterium faecium DSM 4810]
          Length = 201

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 107/192 (55%), Gaps = 6/192 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA R++++L +P +STGD+ RA V   T LG   K  M+ G  + D
Sbjct: 15  RLLIVGPPGAGKGTQAVRVAEELGIPAISTGDIFRANVSGETELGVLAKSYMDKGEYVPD 74

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N ++  R+   D   GF+LDGYPRT+DQ ++L   ++  D ++D V+ L VE   + 
Sbjct: 75  SVTNDMIRSRLAEADAQEGFLLDGYPRTLDQVEALDGMLAEADTSLDMVLLLVVETEEVI 134

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R  E        RSDD  +    R+E Y     PL   Y   G +  +DGM  +D
Sbjct: 135 GRLVARGAE------QGRSDDTEETIRHRLEVYADQTAPLIDVYEKRGLVRRVDGMASID 188

Query: 182 EVSRSIDSLLVS 193
           EV+ ++   L  
Sbjct: 189 EVTAALREALAG 200


>gi|254829060|ref|ZP_05233747.1| adk [Listeria monocytogenes FSL N3-165]
 gi|258601470|gb|EEW14795.1| adk [Listeria monocytogenes FSL N3-165]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LG++ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGRKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D   GF+LDG+PRTV+QA+ L   +S++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLSEDDAKDGFLLDGFPRTVEQAQELENILSDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILTS 214


>gi|288574683|ref|ZP_06393040.1| adenylate kinase [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570424|gb|EFC91981.1| adenylate kinase [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 214

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 22/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA ++ ++  V  +STGD+LRA V   T LG++ K  M++G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAEKIMERHAVAHISTGDILRANVKAETDLGRKAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++ +++ +R++  DC  GF+LDG+PRTV QA++L   +  +   +D V+ L V+D ++
Sbjct: 61  DEVIVEMMEERLQESDCSEGFLLDGFPRTVAQAEALDVMLKKLGLVLDGVVLLDVDDETV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DD+ +V   R+  Y     
Sbjct: 121 VKRLSGRRMCRGCGKIFNVTFKPSAKGDLCDQCGGELYQRDDDREEVIRNRLAVYHNQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL SYY + G L+ ID   D D+V   IDS++  V
Sbjct: 181 PLISYYEERGQLHRIDAA-DGDDVPDKIDSIVGRV 214


>gi|225387217|ref|ZP_03756981.1| hypothetical protein CLOSTASPAR_00969 [Clostridium asparagiforme
           DSM 15981]
 gi|225046696|gb|EEG56942.1| hypothetical protein CLOSTASPAR_00969 [Clostridium asparagiforme
           DSM 15981]
          Length = 236

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LG + K  M++G L+ 
Sbjct: 23  MKIIMLGAPGAGKGTQAKKIAAKYQIPHVSTGDIFRANIKNGTELGMKAKSYMDAGGLVP 82

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   ++ DRI   DC++G++LDG+PRT+ QA+SL   ++ MD  ID  + + V D ++
Sbjct: 83  DEITIGMLLDRIHEADCENGYVLDGFPRTIPQAESLTQALAGMDEKIDYAVNVDVPDENI 142

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    +  +R DDK +   KR+  Y     
Sbjct: 143 ISRMSGRRACLNCGATYHIVYNPPKQEGVCDVCGDKLVLRDDDKPETVQKRLSVYHDQTQ 202

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG  DM+ V + I  +L
Sbjct: 203 PLIEYYEKAGVLKQVDGTQDMEAVFQDIVKIL 234


>gi|163736168|ref|ZP_02143587.1| adenylate kinase [Phaeobacter gallaeciensis BS107]
 gi|161390038|gb|EDQ14388.1| adenylate kinase [Phaeobacter gallaeciensis BS107]
          Length = 231

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 116/214 (54%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA +L Q   + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 16  LILLGPPGAGKGTQARKLEQGFGLVQLSTGDLLRAAVAAGTPAGLAAKAVMEAGELVSDE 75

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++  D  I+A + L V+DA+M  
Sbjct: 76  IVINILRDRLAEPDCAKGVILDGFPRTTVQAEALDRLLAESDQQINAAVSLEVDDAAMVA 135

Query: 123 RI------------------QVRVLEAI----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+                  Q RV        +++ + R+DD  +    R+  Y     P
Sbjct: 136 RVAGRYTCGGCGEGYHDQFKQPRVAGTCDACGSTDMTRRADDNAETVTSRLAAYHAQTAP 195

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L SYY   G L  ID   ++++++ ++ +++ S 
Sbjct: 196 LISYYDGKGVLNRIDATGEINQIATALSAVVKSA 229


>gi|217966190|ref|YP_002351868.1| adenylate kinase (ATP-AMP transphosphorylase)
           (AK)(Superoxide-inducible protein 16) (SOI16) [Listeria
           monocytogenes HCC23]
 gi|255022696|ref|ZP_05294682.1| adenylate kinase [Listeria monocytogenes FSL J1-208]
 gi|254806993|sp|B8DB29|KAD_LISMH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|217335460|gb|ACK41254.1| adenylate kinase (ATP-AMP transphosphorylase)
           (AK)(Superoxide-inducible protein 16) (SOI16) [Listeria
           monocytogenes HCC23]
 gi|307572200|emb|CAR85379.1| adenylate kinase [Listeria monocytogenes L99]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LG++ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGRKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D   GF+LDG+PRTV+QA+ L   +S++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLSEDDAKDGFLLDGFPRTVEQAQELENILSDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVAGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILTS 214


>gi|145225597|ref|YP_001136275.1| adenylate kinase [Mycobacterium gilvum PYR-GCK]
 gi|145218083|gb|ABP47487.1| Adenylate kinase [Mycobacterium gilvum PYR-GCK]
          Length = 187

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 111/191 (58%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +RI+ LGPPG+GKGTQA +L++KL +P +STGD+ R  +  NT LG + K  +++G L+ 
Sbjct: 7   LRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTELGIEAKKYLDAGDLVP 66

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             + N +V DR+   D   GFILDG+PR+V+QAK+L   +      +DAV+E RV +  +
Sbjct: 67  ATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAKALAEMLEKRGLTLDAVVEFRVPEEEL 126

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ R           R DD  DV   R + YR    PL  +Y     L  +D + ++
Sbjct: 127 VSRLKGR----------GREDDTEDVIRNRFKVYRDETAPLLDFYS--ADLKTVDAVGEL 174

Query: 181 DEV-SRSIDSL 190
           DEV  R++ +L
Sbjct: 175 DEVFDRALTAL 185


>gi|16801821|ref|NP_472089.1| adenylate kinase [Listeria innocua Clip11262]
 gi|20138485|sp|Q927M8|KAD_LISIN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|16415296|emb|CAC97986.1| adk [Listeria innocua Clip11262]
 gi|313622244|gb|EFR92758.1| adenylate kinase [Listeria innocua FSL J1-023]
          Length = 215

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 119/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QA+ L   +S++   +DAVI + V+   +
Sbjct: 61  DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAEELENILSDLGTELDAVINIEVDKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +    R+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQREDDKKETVENRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+++V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHSINGEQDINDVFVDVEKILAS 214


>gi|22026816|ref|NP_523836.2| adenylate kinase-2 [Drosophila melanogaster]
 gi|74947162|sp|Q9U915|KAD2_DROME RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|17863032|gb|AAL39993.1| SD09634p [Drosophila melanogaster]
 gi|20043237|dbj|BAA87877.1| Dak2 [Drosophila melanogaster]
 gi|21626704|gb|AAF47139.2| adenylate kinase-2 [Drosophila melanogaster]
 gi|220944508|gb|ACL84797.1| Adk2-PA [synthetic construct]
          Length = 240

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 114/213 (53%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +IDS+    R
Sbjct: 202 DYYGLRGLHFKVDAAKKSSDVFSTIDSIFQRKR 234


>gi|28212159|ref|NP_783103.1| adenylate kinase [Clostridium tetani E88]
 gi|46396111|sp|Q890Q5|KAD_CLOTE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|28204603|gb|AAO37040.1| adenylate kinase [Clostridium tetani E88]
          Length = 216

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 115/215 (53%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  +S+K ++P +STGD+ R  +   T LG + K  M+ G L+ 
Sbjct: 1   MNIILLGPPGAGKGTQAKLISEKYSIPHISTGDIFRKNISNKTPLGMEAKSYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GF+LDG+PRTV QA++L  F+ N     DA + + V    +
Sbjct: 61  DELTIEIVKDRLGEEDCKNGFLLDGFPRTVKQAEALDEFLQNKSSKTDAALLIDVPQELI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    +   R DD  +  L+R+E Y K   
Sbjct: 121 LERMTGRRVCGECGASYHIKFITPKTEGVCDLCGGKLVQRKDDTKETVLERLEVYSKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL  YY++   L  +DG  + +EV  +I ++L ++
Sbjct: 181 PLIEYYKNKNVLLALDGTKEKNEVFENISNVLGAI 215


>gi|297201750|ref|ZP_06919147.1| adenylate kinase [Streptomyces sviceus ATCC 29083]
 gi|197710875|gb|EDY54909.1| adenylate kinase [Streptomyces sviceus ATCC 29083]
          Length = 220

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 117/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L+  L++P +STGD+ RA + R T LGK  K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLASNLSIPHISTGDLFRANISRQTDLGKLAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD ++GF+LDG+PR V QA+SL   + +    +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMEQPDAENGFLLDGFPRNVSQAESLDEMLQHEGMKLDAVLDLEVPEEEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHVSYKAPKQDGVCDVCGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G +  I  +  +++V+ R++++L
Sbjct: 181 EPIIDYYKAQGLVVTISALGKVEDVTGRAMEAL 213


>gi|297192682|ref|ZP_06910080.1| adenylate kinase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721663|gb|EDY65571.1| adenylate kinase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 221

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 116/215 (53%), Gaps = 23/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGKQ K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLSIPHISTGDLFRANISQGTELGKQAKAYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD   GF+LDG+PR V QA++L   +      +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMSQPDAVGGFLLDGFPRNVGQAEALDEMLKGEGVQLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRVCRNNSAHVFHVTYSPAKAEGVCDECGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSLLV 192
            P+  YYR  G +  I  +  + +V+ R++++L V
Sbjct: 181 EPIIDYYRSQGLVVTISALGKVTDVTARAMEALQV 215


>gi|163741303|ref|ZP_02148695.1| adenylate kinase [Phaeobacter gallaeciensis 2.10]
 gi|161385656|gb|EDQ10033.1| adenylate kinase [Phaeobacter gallaeciensis 2.10]
          Length = 231

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 116/214 (54%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA +L Q   + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 16  LILLGPPGAGKGTQARKLEQGFGLVQLSTGDLLRAAVAAGTPAGLAAKAVMEAGELVSDE 75

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++     I+A + L V+DA+M  
Sbjct: 76  IVINILRDRLAEPDCAKGVILDGFPRTTVQAEALDRLLAESGQQINAAVSLEVDDAAMVA 135

Query: 123 RI------------------QVRVLEAI----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+                  Q RV        +++ + R+DD  +    R+  Y     P
Sbjct: 136 RVAGRYTCGGCGEGYHDQFKQPRVAGTCDACGSTDMTRRADDNAETVTSRLAAYHAQTAP 195

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L SYY   G L  ID M ++++++ ++ +++ S 
Sbjct: 196 LISYYDGKGVLNRIDAMGEINQIATALSAVVKSA 229


>gi|325288598|ref|YP_004264779.1| Adenylate kinase [Syntrophobotulus glycolicus DSM 8271]
 gi|324963999|gb|ADY54778.1| Adenylate kinase [Syntrophobotulus glycolicus DSM 8271]
          Length = 214

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA +L +   +P +STGDM RA +   T LG + K  M++G L+ 
Sbjct: 1   MRVILMGPPGAGKGTQAEQLIEYYKIPHISTGDMFRAAIKDQTPLGIKAKEYMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +RI+  DC +GF+LDG+PRT  QA +L   +S+++  +D V+ + V+D ++
Sbjct: 61  DEVTIGIVAERIKKDDCKTGFMLDGFPRTAAQADALAKILSDLNVTLDGVVNIEVDDETL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   RSDD  +    R++ Y     
Sbjct: 121 LQRLTGRRICKKCGATYHMVFNPPAKEGVCDKCKGELYQRSDDTLETAENRLKVYNDQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY + G L  I G  D+++V + I S L
Sbjct: 181 PLIAYYSEQGLLKGIQGKQDINKVLQDIISAL 212


>gi|46908783|ref|YP_015172.1| adenylate kinase [Listeria monocytogenes str. 4b F2365]
 gi|226225156|ref|YP_002759263.1| adenylate kinase [Listeria monocytogenes Clip81459]
 gi|68568777|sp|Q71WG7|KAD_LISMF RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|259494010|sp|C1KZF9|KAD_LISMC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|46882056|gb|AAT05349.1| adenylate kinase [Listeria monocytogenes serotype 4b str. F2365]
 gi|225877618|emb|CAS06332.1| Putative adenylate kinase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|328468096|gb|EGF39102.1| adenylate kinase [Listeria monocytogenes 1816]
 gi|328469783|gb|EGF40700.1| adenylate kinase [Listeria monocytogenes 220]
          Length = 215

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 119/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QA+ L   ++++   +DAVI + V+   +
Sbjct: 61  DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAEELENILNDLGTELDAVINIEVDKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILAS 214


>gi|299541953|ref|ZP_07052276.1| adenylate kinase [Lysinibacillus fusiformis ZC1]
 gi|298725691|gb|EFI66332.1| adenylate kinase [Lysinibacillus fusiformis ZC1]
          Length = 217

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 118/216 (54%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +G PG+GKGTQA ++ +K  +P +STGDM RA +   T LG Q K  M+ G+L+ 
Sbjct: 1   MNIVLMGLPGAGKGTQADKIVEKYAIPHISTGDMFRAAIKEGTELGLQAKSFMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC+ GF+LDG+PRTV QA++L + ++++  AI+  + ++VE   +
Sbjct: 61  DEVTIGIVRERLAKPDCEKGFLLDGFPRTVPQAEALDSILADLGKAIEHTLNIQVEKDEL 120

Query: 121 FKRIQVR------------VLEAIASEKS---------VRSDDKYDVFLKRIENYRKTIL 159
             R+  R            +    A E            R+DD  +    R+E   K   
Sbjct: 121 IARLSGRRICKTCGTSYHLIFNPPAEEGKCDKDGGELYTRADDNPETVANRLEVNMKQAQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y+  G L  IDG  D+++V   +D+LL S R
Sbjct: 181 PLLDFYQAKGVLTNIDGQQDINKVFADLDALLQSSR 216


>gi|282860831|ref|ZP_06269897.1| adenylate kinase [Streptomyces sp. ACTE]
 gi|282564567|gb|EFB70103.1| adenylate kinase [Streptomyces sp. ACTE]
          Length = 218

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAKNLSIPHISTGDLFRANISQGTDLGKQARAYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  +GF+LDG+PR V QA++L A +      +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMAQPDAGNGFLLDGFPRNVGQAEALDAMLREEGVTLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +    R+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVTYNPPKTDGVCDECGGELYQRDDDSEETVRTRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YYR  G +  I  +  + EV+ R++++L
Sbjct: 181 EPIIDYYRTQGLVVTISALGKVTEVTERAMEAL 213


>gi|195430900|ref|XP_002063486.1| GK21378 [Drosophila willistoni]
 gi|224493086|sp|B4MQT3|KAD2_DROWI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|194159571|gb|EDW74472.1| GK21378 [Drosophila willistoni]
          Length = 240

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 112/213 (52%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M+ G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDEGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAV+E  ++D  + +R
Sbjct: 82  VVNMIDSNLDKPECKNGFLLDGFPRTVVQAQKLDTLLDKRKTNLDAVVEFSIDDNLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E+Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKQPMKDDITGEPLIRRSDDNAEALKKRLESYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V   IDS+    R
Sbjct: 202 DYYGFRGLHFKVDAARKSSDVFSKIDSIFQRQR 234


>gi|305663909|ref|YP_003860197.1| Adenylate kinase [Ignisphaera aggregans DSM 17230]
 gi|304378478|gb|ADM28317.1| Adenylate kinase [Ignisphaera aggregans DSM 17230]
          Length = 215

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 119/208 (57%), Gaps = 18/208 (8%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+F+GPPG GKGT A  L+QK  +P +STGD+ R E+ + + LG++VK  +E G L+ 
Sbjct: 1   MRIVFIGPPGIGKGTYAKILNQKYGIPHISTGDIFREEIAKGSELGQKVKYYVERGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAI------DAVIE-- 112
           D IV +V+  R+  PDC+ GFILDG+PRT++QA +L   I+ +D AI      D +IE  
Sbjct: 61  DEIVIEVIKHRLSKPDCEKGFILDGFPRTINQAIALDN-ITKIDAAIVFEAPLDVIIERV 119

Query: 113 ---LRVEDASMFKRIQVR------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSS 163
              L   +      I+ +      + +   S+   R DD  +V  KR E Y++T  P+  
Sbjct: 120 SGRLICPNCGAIYHIRWKPPKNPWICDVCGSKLVRREDDSPEVVKKRFEIYKQTFSPVIE 179

Query: 164 YYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           YYR  G L  ID   +  EV + ++ +L
Sbjct: 180 YYRAKGILIEIDASKEASEVVKELEKIL 207


>gi|302382639|ref|YP_003818462.1| adenylate kinase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193267|gb|ADL00839.1| adenylate kinase [Brevundimonas subvibrioides ATCC 15264]
          Length = 188

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 111/192 (57%), Gaps = 6/192 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++  + QLSTGDMLR  +   + LG+Q K  M  G LI+
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEQRGMVQLSTGDMLREAIASGSDLGQQCKEIMSKGGLIA 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++  R+   +   G I DG+PRT+ QA++L A ++ +D  IDAV+ L+V+D ++
Sbjct: 61  DDIVIALIEARLTEAEEAGGAIFDGFPRTIAQAEALDAMLAKLDKKIDAVVRLKVDDEAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R  +        R DD  + F  R++ Y +   PL  YY D G L  +DGM  +
Sbjct: 121 LERVSKRFAD------QGRPDDNPESFKVRLDAYNRNTAPLLPYYSDKGLLTEVDGMGSI 174

Query: 181 DEVSRSIDSLLV 192
           + V+ +I   L 
Sbjct: 175 ETVATAISGALA 186


>gi|255519661|ref|ZP_05386898.1| adenylate kinase [Listeria monocytogenes FSL J1-175]
          Length = 214

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 119/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QA+ L   ++++   +DAVI + V+   +
Sbjct: 61  DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAEELENILNDLGTELDAVINIEVDKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQDIKDVFVDVEKILAS 214


>gi|152979476|ref|YP_001345105.1| adenylate kinase [Actinobacillus succinogenes 130Z]
 gi|171704365|sp|A6VQC3|KAD_ACTSZ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|150841199|gb|ABR75170.1| Nucleoside-triphosphate--adenylate kinase [Actinobacillus
           succinogenes 130Z]
          Length = 214

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 118/218 (54%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLRA +   T LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMLRAAIKAGTELGKQAKTLMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V DR+  PDC+ GF+LDG+PRT+ QA +L A        ID V+E  V D  +
Sbjct: 61  DDLIIALVQDRVAQPDCEKGFLLDGFPRTIPQADALKA----AGIGIDYVLEFDVADEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R++ Y  T 
Sbjct: 117 VERMSGRRVHP-ASGRSYHVVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLKVYHTTT 175

Query: 159 LPLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++ VSR +D +L
Sbjct: 176 RPLVDYYQAEAKAGNTRYFRLDGTQPVEAVSRELDKIL 213


>gi|56751893|ref|YP_172594.1| adenylate kinase [Synechococcus elongatus PCC 6301]
 gi|81301022|ref|YP_401230.1| adenylate kinase [Synechococcus elongatus PCC 7942]
 gi|6225579|sp|O24706|KAD_SYNP6 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123556370|sp|Q31L26|KAD_SYNE7 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|2446909|dbj|BAA22468.1| adenylate kinase [Synechococcus elongatus PCC 6301]
 gi|56686852|dbj|BAD80074.1| adenylate kinase [Synechococcus elongatus PCC 6301]
 gi|81169903|gb|ABB58243.1| Adenylate kinase [Synechococcus elongatus PCC 7942]
          Length = 186

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 118/193 (61%), Gaps = 11/193 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IFLGPPG+GKGTQA  ++++L +  +STG++LRA V   T LG + KG M+ G L+ D
Sbjct: 3   RLIFLGPPGAGKGTQAVVVAEQLQLAHISTGELLRAAVTAQTPLGIEAKGYMDRGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++V  +V DR++ PD  +G+ILDG+PR   QA++L+  ++ ++  +D  + L V D  + 
Sbjct: 63  SLVLGLVRDRLQQPDTANGWILDGFPRNRSQAEALNLLLTEINQQVDRAVNLDVPDPVII 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R+DD   V  +R+E YR+   PL  ++RD   L  IDG  ++ 
Sbjct: 123 ERMLAR----------GRADDTESVIRRRLEVYREQTAPLIDFFRDRQQLLAIDGNSEVA 172

Query: 182 EVS-RSIDSLLVS 193
            V+ R + +L V+
Sbjct: 173 AVTDRLVSALQVA 185


>gi|296268571|ref|YP_003651203.1| adenylate kinase [Thermobispora bispora DSM 43833]
 gi|296091358|gb|ADG87310.1| adenylate kinase [Thermobispora bispora DSM 43833]
          Length = 217

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++  L+VP++STGD+ RA V R T LGK  K  M+ G L+ 
Sbjct: 1   MRVVLVGPPGAGKGTQAQYIASHLSVPKISTGDIFRANVSRGTELGKLAKEYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   D   GF+LDG+PR V QA+ L   ++    ++D V+EL+V+D  +
Sbjct: 61  DEVTIAMVRDRLLQDDAREGFLLDGFPRNVPQAEVLKEMLAEFGASLDVVLELKVDDEEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +A   E   R DD+ +   +R+E Y++   
Sbjct: 121 IRRLSGRRTCRSCGKVWHVVFDPPAVEGVCDACGGELFQRDDDREETIRRRLEVYQEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL S+Y   G L  ID    ++EV++   S+L
Sbjct: 181 PLISFYEKEGILAGIDATGPVEEVTQRALSVL 212


>gi|299820976|ref|ZP_07052865.1| adenylate kinase [Listeria grayi DSM 20601]
 gi|299817997|gb|EFI85232.1| adenylate kinase [Listeria grayi DSM 20601]
          Length = 215

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++  K N+P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVSKYNIPHISTGDMFRAAIKNGTALGLKAKSFMDEGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD   GF+LDG+PRTV+QA+ L A +S +   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLAEPDAKDGFLLDGFPRTVEQAEELEAILSELGTELDAVINIEVEKDVL 120

Query: 121 FKRIQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTIL 159
            KR+  R +         E     K+             R DDK +    R+    K   
Sbjct: 121 IKRLTGRWICPTCGRTYHELYNPPKTAGVCDDDGSKLYQREDDKKETVENRLNVNLKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L  ++G  ++  V + +D +L S
Sbjct: 181 PLLDFYTEKGKLASVNGEQEIQSVFQDVDKILTS 214


>gi|257463984|ref|ZP_05628369.1| adenylate kinase [Fusobacterium sp. D12]
 gi|317061506|ref|ZP_07925991.1| adenylate kinase [Fusobacterium sp. D12]
 gi|313687182|gb|EFS24017.1| adenylate kinase [Fusobacterium sp. D12]
          Length = 208

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  +  +  +PQ+STGD+LR  +   T LG + K  M+ G L+ 
Sbjct: 1   MNIVLFGAPGAGKGTQAKFIVDQYEIPQISTGDILRQAIANKTKLGLEAKKFMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA+VN +V +R+   DC+ GFI+DG+PRTV QA+ L   +  +   I+ VI L V D  +
Sbjct: 61  DAVVNGLVAERLEQADCEKGFIMDGFPRTVVQAEELDKILEKLHKKIEKVIALNVNDEEI 120

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                 ++   ++   R+DD  +V  KR+  Y +   P+  Y
Sbjct: 121 VERITGRRTSKKTGKIYHMTFNPPVDEDPADLVQRADDTKEVVEKRLRTYHEQTAPVLDY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   M+E+++ I S+L
Sbjct: 181 YKSQNKVSEIDGSQKMEEITKQIFSIL 207


>gi|158319564|ref|YP_001512071.1| adenylate kinase [Alkaliphilus oremlandii OhILAs]
 gi|166980294|sp|A8MLG1|KAD_ALKOO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|158139763|gb|ABW18075.1| Adenylate kinase [Alkaliphilus oremlandii OhILAs]
          Length = 216

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  + +K ++P +STGD+ R  + + T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAASIVEKYHIPHISTGDIFRYNIKQGTELGKKAKSYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V ++V DR++  DC++GF+LDG+PRTV QA++L   + +M+ ++D VI ++V+   +
Sbjct: 61  DEVVVEIVEDRLKKEDCENGFLLDGFPRTVVQAEALDKALVDMNISLDKVINIQVDKERL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     + +    E   R DD  +   +RIE Y     
Sbjct: 121 IERAVGRRICRECGATFHVQYNPSTKGALCDQCGGELYQRDDDNEETVTRRIEVYLSETT 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY     L  IDG   ++EV  +I + L S
Sbjct: 181 PLVEYYSSQNKLVTIDGDKKINEVFANIVTSLGS 214


>gi|319944101|ref|ZP_08018379.1| adenylate kinase [Lautropia mirabilis ATCC 51599]
 gi|319742595|gb|EFV95004.1| adenylate kinase [Lautropia mirabilis ATCC 51599]
          Length = 218

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 122/222 (54%), Gaps = 33/222 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  ++ +  +PQ+STGDMLRA +   T LGK  K  M+ G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAGFITSQFGIPQISTGDMLRAAIKAGTELGKAAKEVMDQGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R++ PDC +G++ DG+PRT+ QA++L          ++ V+EL+V DA +
Sbjct: 61  DDIIIGLVKERLKQPDCQNGYLFDGFPRTIPQAEALR----ESGIRLEHVVELKVPDADI 116

Query: 121 FKRIQVRVLEAIASEK---------------------SVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +   +                        + R DD+ DV  KR+E Y++   
Sbjct: 117 IERMSGRRVHQPSGRSYHIRFNPPKVEGKDDVTGEPLTQRDDDREDVVRKRLEVYQQQTR 176

Query: 160 PLSSYYRDMG--------CLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY++            + ++G+  ++E+   + + LVS
Sbjct: 177 PLVDYYQEWARTGDAAAPRYHALEGVGTLEEIRARVQAALVS 218


>gi|167748451|ref|ZP_02420578.1| hypothetical protein ANACAC_03195 [Anaerostipes caccae DSM 14662]
 gi|317472016|ref|ZP_07931348.1| adenylate kinase [Anaerostipes sp. 3_2_56FAA]
 gi|167652443|gb|EDR96572.1| hypothetical protein ANACAC_03195 [Anaerostipes caccae DSM 14662]
 gi|316900420|gb|EFV22402.1| adenylate kinase [Anaerostipes sp. 3_2_56FAA]
          Length = 214

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++++ N+P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIAEQYNIPHISTGDIFRANIKNGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI   DC  GFILDG+PRT+ QA++L A ++  D  ID  +++ V D ++
Sbjct: 61  DELVVDLVVDRIEKDDCQKGFILDGFPRTIPQAEALDAALAAKDMKIDYALDIEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +  + E  +R DDK +   KR++ Y +   
Sbjct: 121 IDRMSGRRSCRECGAIFHAKYNPPKSEGICDICSGELILRDDDKEETVKKRLDVYHEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL S+Y+  G L+ IDG   +D V   I S+L
Sbjct: 181 PLISHYKSAGSLHEIDGTRHIDVVFDEIKSIL 212


>gi|325663041|ref|ZP_08151491.1| adenylate kinase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086648|ref|ZP_08335725.1| adenylate kinase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470495|gb|EGC73725.1| adenylate kinase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409814|gb|EGG89249.1| adenylate kinase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 214

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYQIPHISTGDIFRANIKNGTELGKQAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+   DC +G++LDG+PRT+ QA++L   +  +   +D  I + V D ++
Sbjct: 61  DELVVNLVVDRVNQEDCKNGYVLDGFPRTIPQAEALDRALEALGQKVDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +   ++  +R DD+ +  LKR+  Y +   
Sbjct: 121 VNRMSGRRACVGCGATYHVEYAPTKVENVCDVCGADLILREDDQPETVLKRLGVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY +   L  +DG +DM+ V  +I  +L
Sbjct: 181 PLIQYYTEKHVLKEVDGTVDMEAVFAAIVEIL 212


>gi|116873977|ref|YP_850758.1| adenylate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|123458728|sp|A0ALU7|KAD_LISW6 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|116742855|emb|CAK21979.1| adenylate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 215

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D  +GF+LDG+PRTV+QA  L   +S++   +DAVI + V+   +
Sbjct: 61  DEVTNGIVRERLAEDDAKNGFLLDGFPRTVEQAAELENILSDLGTELDAVINIEVDKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +    R+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVAGKCDLDGGELYQREDDKKETVENRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  D+++V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHSINGEQDINDVFVDVEKILAS 214


>gi|295109495|emb|CBL23448.1| Adenylate kinase [Ruminococcus obeum A2-162]
          Length = 214

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA ++++K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIIMLGAPGAGKGTQAKKIAEKYGIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  D  +G++LDG+PRT+ QA+ L A +  +   ID  I++ V D ++
Sbjct: 61  DELTCDLVVDRIQQDDAKNGYVLDGFPRTIPQAECLTAALEKLGSKIDYAIDVDVPDENI 120

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
             R+  R           ++ A   ++++          R DDK +   KR++ Y +   
Sbjct: 121 VNRMSGRRACLKCGATYHIVYAAPKKENICDTCGEALVLRDDDKPETVSKRLKVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG   +DEV ++I  +L
Sbjct: 181 PLIDYYTKQGVLKTVDGTCALDEVFKAIVEIL 212


>gi|195028398|ref|XP_001987063.1| GH21708 [Drosophila grimshawi]
 gi|224493077|sp|B4J672|KAD2_DROGR RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|193903063|gb|EDW01930.1| GH21708 [Drosophila grimshawi]
          Length = 238

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 113/210 (53%), Gaps = 21/210 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG  +K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIASGSKLGSDLKKVMDAGKLVSDDL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D  + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTHLDAVIEFAIDDNLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E+Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKVPMKDDITGELLMRRSDDNAEALKKRLESYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
            YY   G  + +D      +V  SIDS+ +
Sbjct: 202 DYYGLRGLHFKVDAAKKASDVFSSIDSIFL 231


>gi|323706471|ref|ZP_08118032.1| adenylate kinase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534191|gb|EGB23981.1| adenylate kinase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 216

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +++   +P +STGD+ R  +  NT LGK  K  ++ G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAESITRDYKIPHISTGDIFRYNIKNNTELGKLAKQYIDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+   DC  GF+LDGYPR V QA++L  ++   +  ID VI + V+   +
Sbjct: 61  DDVTNRIVEDRLSKDDCKEGFLLDGYPRNVSQAEALDRYLGERNLKIDHVINIVVDRDEL 120

Query: 121 FKRIQVR-----------------VLEAI---ASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+  R                  +E I     EK + R+DD  D  LKR+E Y     
Sbjct: 121 VKRLSGRRVCPSCGATYHIFTKPPKVEGICDNCGEKLIQRTDDNIDSVLKRLEVYEDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY ++  +  I+G   ++EV   I +L+
Sbjct: 181 PLVEYYGNLNLIRNINGNKPVNEVFEEIQALI 212


>gi|168181885|ref|ZP_02616549.1| adenylate kinase [Clostridium botulinum Bf]
 gi|237796921|ref|YP_002864473.1| adenylate kinase [Clostridium botulinum Ba4 str. 657]
 gi|259493993|sp|C3KVN0|KAD_CLOB6 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|182674791|gb|EDT86752.1| adenylate kinase [Clostridium botulinum Bf]
 gi|229263865|gb|ACQ54898.1| adenylate kinase [Clostridium botulinum Ba4 str. 657]
          Length = 216

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ RA +   T LG + K  +++G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAKLISEKFSIPHISTGDIFRANIKEKTPLGIEAKRYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKELDVALLIKVPEEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   +DEV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESIDEVFGNISNIL 212


>gi|194754367|ref|XP_001959467.1| GF12891 [Drosophila ananassae]
 gi|224493072|sp|B3MCQ5|KAD2_DROAN RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|190620765|gb|EDV36289.1| GF12891 [Drosophila ananassae]
          Length = 240

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 114/213 (53%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D+ + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKANLDAVIEFAIDDSLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLMRRSDDNAEALKKRLEAYHKQTRPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +ID++    R
Sbjct: 202 DYYGLRGLHFKVDAAKKSSDVFSTIDTIFQRQR 234


>gi|260434483|ref|ZP_05788453.1| adenylate kinase (ATP-AMP transphosphorylase) [Synechococcus sp. WH
           8109]
 gi|260412357|gb|EEX05653.1| adenylate kinase (ATP-AMP transphosphorylase) [Synechococcus sp. WH
           8109]
          Length = 183

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 115/190 (60%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL    ++  LSTGD+LR+EV   + LGK+ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCDANSMKHLSTGDLLRSEVAAGSDLGKEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  +++    D G++LDG+PRTV QA++L   ++ +   I AV+ L ++DA + 
Sbjct: 64  ALVLAIVESQMKALTTD-GWLLDGFPRTVPQAEALEPLLAELQQPIQAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R+DD   V   R+E YR+   PL  +Y D G L  +     ++
Sbjct: 123 ERLLAR----------GRADDNEAVIRNRLEVYREKTAPLIRFYSDKGLLVSVPAQGSVE 172

Query: 182 EVSRSIDSLL 191
           E+++ I+S+L
Sbjct: 173 EITKRIESVL 182


>gi|222529710|ref|YP_002573592.1| adenylate kinase [Caldicellulosiruptor bescii DSM 6725]
 gi|312622065|ref|YP_004023678.1| adenylate kinase [Caldicellulosiruptor kronotskyensis 2002]
 gi|254806967|sp|B9MKG1|KAD_ANATD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|222456557|gb|ACM60819.1| adenylate kinase [Caldicellulosiruptor bescii DSM 6725]
 gi|312202532|gb|ADQ45859.1| adenylate kinase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 215

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS++ ++P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEYLSKRFSIPHISTGDILRENVKNETELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V DR+   DC +GF+LDG+PRT+ QA++L   +  +   ID V+ + V D  +
Sbjct: 61  DEIVIEIVKDRLSKEDCKNGFLLDGFPRTIAQAEALDKVLEELGQKIDKVLNIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKNCGASFHVIYRPPQKEGVCDVCGGELYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+  G L +  G  ++ + ++ +
Sbjct: 181 PLIDYYKAKGLLVVAYGQEEIADTTKEV 208


>gi|209527122|ref|ZP_03275636.1| adenylate kinase [Arthrospira maxima CS-328]
 gi|209492462|gb|EDZ92803.1| adenylate kinase [Arthrospira maxima CS-328]
          Length = 192

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 113/199 (56%), Gaps = 18/199 (9%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPGSGKGTQA R+++ + +P +STG++LR  V + T LG+Q K  M+ G L+ D 
Sbjct: 4   LIFLGPPGSGKGTQAARMAEIMKIPHISTGEILRDHVSKQTPLGQQAKTYMDLGDLVPDQ 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAID--------AVIELR 114
           ++  +V  R+  PD ++G+ILDG+PR V QA+ +   + ++D             VI L 
Sbjct: 64  LILDMVTHRLSEPDAETGWILDGFPRNVSQAQFVQEHLLSVDEKTGKIPDKDHVWVINLE 123

Query: 115 VEDASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYII 174
           V D  + KR+ VR           R DD  +  L R++ YR+   PL  +Y     L+ I
Sbjct: 124 VPDDVILKRLLVR----------GREDDHEETILHRLQVYREQTAPLIEFYSSRNQLHHI 173

Query: 175 DGMLDMDEVSRSIDSLLVS 193
           +G   M+EV+ S+  ++ S
Sbjct: 174 NGDRTMEEVTDSLKEVITS 192


>gi|323451568|gb|EGB07445.1| hypothetical protein AURANDRAFT_27862 [Aureococcus anophagefferens]
          Length = 234

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 118/222 (53%), Gaps = 33/222 (14%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II  GPPG+GKGTQA R+ ++L  PQLSTGDMLRA V   T +GK+  G M+SG L+SD 
Sbjct: 11  IILFGPPGAGKGTQAPRIVEQLGTPQLSTGDMLRAAVAAGTDVGKEADGVMKSGGLVSDD 70

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V  ++ DRI  PDC  GF+LDG+PRTV QA+ L A ++    ++  V+ L V DA + +
Sbjct: 71  LVVAIIKDRIDQPDCHRGFLLDGFPRTVGQAEKLDALLAAKGESVTMVLRLEVPDADLEE 130

Query: 123 RIQVRVLE-----------------AIASEKSV--------------RSDDKYDVFLKRI 151
           RI  R +                  A  +E S               R+DD  +    R+
Sbjct: 131 RICGRWIHKASGRSYHAKFKPPKSLAEGAEPSAETMLDDESGEPLSQRADDTKEALQSRL 190

Query: 152 ENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           + Y +   PL  +Y+ +  + ++D      E+   +D+L+ +
Sbjct: 191 KGYHEMTTPLLEHYKPV--VKLVDAAKKPAEIFPQVDTLIAN 230


>gi|312127246|ref|YP_003992120.1| adenylate kinase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777265|gb|ADQ06751.1| adenylate kinase [Caldicellulosiruptor hydrothermalis 108]
          Length = 215

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS++ ++P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEYLSKRFSIPHISTGDILRENVKNETELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V DR+   DC +GF+LDG+PRT+ QA++L   +  +   ID V+ + V D  +
Sbjct: 61  DEIVIEIVKDRLSKEDCKNGFLLDGFPRTIAQAEALDKVLQELGQKIDKVLNIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKNCGASFHVIYRPPQKEGVCDVCGGELYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+  G L +  G  ++ + ++ +
Sbjct: 181 PLIDYYKAKGLLVVAYGQEEIADTTKEV 208


>gi|225574723|ref|ZP_03783333.1| hypothetical protein RUMHYD_02800 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038052|gb|EEG48298.1| hypothetical protein RUMHYD_02800 [Blautia hydrogenotrophica DSM
           10507]
          Length = 214

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIIMLGAPGAGKGTQAKKIAAKYGIPHISTGDIFRANIKEGTELGKKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR++  D   G++LDG+PRT+ QA+SL   +  ++  ID  I++ V D ++
Sbjct: 61  DELVVDLVVDRLQQEDAQKGYVLDGFPRTIPQAESLDEALKKVNSKIDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +A   +  +R DDK +   KR+  Y +   
Sbjct: 121 INRMSGRRACVKCGATYHLMYAPTKVEGICDACGDKLILRDDDKPETVKKRLNVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  +DG  DM++V R+I ++L
Sbjct: 181 PLIDYYTSAKVLKRVDGTQDMEDVFRAIVAIL 212


>gi|296395267|ref|YP_003660151.1| adenylate kinase [Segniliparus rotundus DSM 44985]
 gi|296182414|gb|ADG99320.1| adenylate kinase [Segniliparus rotundus DSM 44985]
          Length = 182

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 115/190 (60%), Gaps = 13/190 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+I  G PG+GKGTQ+  LS+ L VP +STGD+ RA +  NT LG++ K  +++G+L+  
Sbjct: 3   RVIMFGYPGAGKGTQSALLSKALGVPHVSTGDLFRANIGENTPLGQEAKKYLDAGNLVPS 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N +V DR+  PD   GF+LDGYPRT+DQA++L A ++ +   +D V+   + +  + 
Sbjct: 63  SVTNAMVKDRLAQPDAKDGFVLDGYPRTLDQAEALTAILAELGQQLDTVLSFEIPEEVVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R++ R           R DD  ++   R+E +RK   PL  YY  +  +  I+ +  +D
Sbjct: 123 ERMRAR----------GRQDDTDEIIKARLEIHRKETEPLLQYYESL--VVAINAVGTVD 170

Query: 182 EV-SRSIDSL 190
           EV +R++ +L
Sbjct: 171 EVQARALKAL 180


>gi|254391372|ref|ZP_05006575.1| adenylate kinase [Streptomyces clavuligerus ATCC 27064]
 gi|294814488|ref|ZP_06773131.1| Adenylate kinase [Streptomyces clavuligerus ATCC 27064]
 gi|326442877|ref|ZP_08217611.1| adenylate kinase [Streptomyces clavuligerus ATCC 27064]
 gi|197705062|gb|EDY50874.1| adenylate kinase [Streptomyces clavuligerus ATCC 27064]
 gi|294327087|gb|EFG08730.1| Adenylate kinase [Streptomyces clavuligerus ATCC 27064]
          Length = 214

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 22/207 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LG+Q K  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAENLSIPHISTGDLFRANISQGTDLGRQAKSYMDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD   GF+LDG+PR V QA++L A + +    +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMERPDATGGFLLDGFPRNVSQAEALDAMLKSEGMTLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR------------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTI 158
            KRI  R            V  +  +++ V          R DD      KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVTYSPPAQEGVCDVCGGDLYQRDDDSETTVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            P+  YYR  G +  I  +  + EV++
Sbjct: 181 EPIIDYYRGQGLVVTISALGKVTEVTQ 207


>gi|195122714|ref|XP_002005856.1| GI20701 [Drosophila mojavensis]
 gi|224493076|sp|B4KLY1|KAD2_DROMO RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|193910924|gb|EDW09791.1| GI20701 [Drosophila mojavensis]
          Length = 240

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 113/209 (54%), Gaps = 21/209 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M+ G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIASGSKLGAELKKVMDEGKLVSDDL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L + +     ++DAVIE  ++D  + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAQKLDSLLDKRKTSLDAVIEFAIDDNLLVRR 141

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKVPMKDDITGEPLMKRSDDNAEALKKRLEAYHKQTKPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            YY   G  + +D      +V  +IDS+ 
Sbjct: 202 DYYGLRGLHFKVDAAKKASDVFSTIDSIF 230


>gi|58580586|ref|YP_199602.1| adenylate kinase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622536|ref|YP_449908.1| adenylate kinase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|81311969|sp|Q5H4A4|KAD_XANOR RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123523026|sp|Q2P743|KAD_XANOM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|58425180|gb|AAW74217.1| adenylate kinase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366476|dbj|BAE67634.1| adenylate kinase [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 187

 Score =  138 bits (347), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 107/187 (57%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFEIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA +L A +S +   +DAV++L V    +
Sbjct: 61  DDILLGMLEARLGQADVAKGFILDGYPRNVAQANALCALLSKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLTRVDGVGSL 174

Query: 181 DEVSRSI 187
           DEV   I
Sbjct: 175 DEVLERI 181


>gi|167767782|ref|ZP_02439835.1| hypothetical protein CLOSS21_02317 [Clostridium sp. SS2/1]
 gi|167710521|gb|EDS21100.1| hypothetical protein CLOSS21_02317 [Clostridium sp. SS2/1]
          Length = 232

 Score =  138 bits (347), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++Q  ++P +STGD+ RA +   T LGK+ +  M+ G L+ 
Sbjct: 20  MKIIMLGAPGAGKGTQAKQIAQAYDIPHISTGDIFRANIKEGTELGKKAQEYMDKGLLVP 79

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI   DC+ G+ILDG+PRT+ QA +L   ++     I+  I++ V D ++
Sbjct: 80  DELVCDLVVDRIHKDDCEKGYILDGFPRTIPQANALDEALAKDGEKIEFAIDIEVPDENI 139

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +    E  +R DDK +   KR++ Y +   
Sbjct: 140 INRMSGRRSCKDCGAIFHVQYNPPKKENCCDVCGGELILRDDDKAETVKKRLDVYHEQTA 199

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL ++Y++ G L+ IDG  D+  V   I S+L
Sbjct: 200 PLIAHYKEAGSLHEIDGTQDIKVVFEEIKSIL 231


>gi|291298732|ref|YP_003510010.1| adenylate kinase [Stackebrandtia nassauensis DSM 44728]
 gi|290567952|gb|ADD40917.1| adenylate kinase [Stackebrandtia nassauensis DSM 44728]
          Length = 217

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 120/212 (56%), Gaps = 22/212 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++ +L+VP++STGD+ RA V   T LG + K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEYIATQLSVPKISTGDIFRANVTGGTPLGVEAKRYMDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+  PD   GF+LDG+PRTV QA++L   +++M   +D V+EL V+D  +
Sbjct: 61  DKVTIDMVRDRLAEPDAVDGFLLDGFPRTVPQAQALDKLLADMGTGLDLVLELVVDDDEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DDK +    R+E Y +   
Sbjct: 121 IRRLSGRRTCHGCGKIWHVEFDRTEVEGVCDRCGGELYQRDDDKAETIATRLEVYNRETA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
           PL  +Y + G L  ID    +++V+ R++D+L
Sbjct: 181 PLIGFYGNTGKLVGIDATGPVEDVTARALDAL 212


>gi|166368465|ref|YP_001660738.1| adenylate kinase [Microcystis aeruginosa NIES-843]
 gi|166090838|dbj|BAG05546.1| adenylate kinase [Microcystis aeruginosa NIES-843]
          Length = 188

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 109/192 (56%), Gaps = 10/192 (5%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPGSGKGTQA +L++ L +P +STG++LR  +   T LG+Q +  +E G L+ D 
Sbjct: 7   VIFLGPPGSGKGTQAAKLAESLTIPHISTGEILRQAITEKTELGQQAQAYVEKGELVPDE 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++  ++ +R++ PD   G+ILDG+PRTV QA  L A +  +  +   V+ L V D  + +
Sbjct: 67  LLLGLIQERLKQPDSAKGWILDGFPRTVAQASFLDALLEELADSYTFVVNLAVPDTVLIE 126

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R           R DD  +   +R++ Y     P+  YY   G L  IDG   MD 
Sbjct: 127 RLMQR----------GRQDDTKETISRRLQVYIDQTAPVLDYYGQKGTLNHIDGNQPMDA 176

Query: 183 VSRSIDSLLVSV 194
           V+ ++ +++  V
Sbjct: 177 VTAALTAVVTPV 188


>gi|291558877|emb|CBL37677.1| Adenylate kinase [butyrate-producing bacterium SSC/2]
          Length = 227

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++Q  ++P +STGD+ RA +   T LGK+ +  M+ G L+ 
Sbjct: 15  MKIIMLGAPGAGKGTQAKQIAQAYDIPHISTGDIFRANIKEGTELGKKAQEYMDKGLLVP 74

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI   DC+ G+ILDG+PRT+ QA +L   ++     I+  I++ V D ++
Sbjct: 75  DELVCDLVVDRIHKDDCEKGYILDGFPRTIPQANALDEALAKDGEKIEFAIDIEVPDENI 134

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +    E  +R DDK +   KR++ Y +   
Sbjct: 135 INRMSGRRSCKDCGAIFHVQYNPPKKENCCDVCGGELILRDDDKAETVKKRLDVYHEQTA 194

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL ++Y++ G L+ IDG  D+  V   I S+L
Sbjct: 195 PLIAHYKEAGSLHEIDGTQDIKVVFEEIKSIL 226


>gi|86137277|ref|ZP_01055854.1| adenylate kinase [Roseobacter sp. MED193]
 gi|85825612|gb|EAQ45810.1| adenylate kinase [Roseobacter sp. MED193]
          Length = 227

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 114/212 (53%), Gaps = 22/212 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  GK  K  MESG L+SD 
Sbjct: 12  LILLGPPGAGKGTQARVLEERFGLVQLSTGDLLRAAVAAGTEAGKAAKAVMESGGLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L   ++     I+A + L V+D++M  
Sbjct: 72  IVINILRDRLAEPDCAKGVILDGFPRTTVQAEALDVLLAETGQKINAAVSLEVDDSAMVA 131

Query: 123 RIQVRVL--------------EAIA-------SEK-SVRSDDKYDVFLKRIENYRKTILP 160
           R+  R                 A+A       SE  + R+DD  +    R+  Y +   P
Sbjct: 132 RVSGRYTCGGCGEGYHDSFKQPAVAGTCDKCGSENMTRRADDNAETVASRLAAYHEQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
           L +YY   G L  ID M +++ +S  +  ++ 
Sbjct: 192 LIAYYDGKGVLKKIDAMGEIEAISGGLAKIVT 223


>gi|311693688|gb|ADP96561.1| adenylate kinase [marine bacterium HP15]
          Length = 217

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 25/191 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  ++++ ++PQ+STGDMLRA V   + LGKQVK  M +G L+S
Sbjct: 1   MRIIMLGAPGAGKGTQAQFITERFDIPQISTGDMLRAAVKAESELGKQVKEVMATGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI+ PDC +GF+LDG+PRT+ QA++L     +   AID V+E+ V+D  +
Sbjct: 61  DDIIIALIEERIQQPDCKNGFLLDGFPRTIPQAEAL----KDQGIAIDYVVEIAVDDEEI 116

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   RV E       V                    R DDK +   KR++ Y     
Sbjct: 117 VSRLSGRRVHEGSGRIYHVKYDPPKVEGKDDQTGEPLVQREDDKEETVRKRLKIYHDQTA 176

Query: 160 PLSSYYRDMGC 170
           PL  YY+D   
Sbjct: 177 PLVGYYQDWAS 187


>gi|171688784|ref|XP_001909332.1| hypothetical protein [Podospora anserina S mat+]
 gi|224493054|sp|B2B0E2|KAD1_PODAN RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|170944354|emb|CAP70464.1| unnamed protein product [Podospora anserina S mat+]
          Length = 276

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 120/224 (53%), Gaps = 24/224 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I +GPPG+GKGTQA RL +K N   L+TGDMLR++V + T LG+  K  M++G L+S
Sbjct: 42  VRAILIGPPGAGKGTQAPRLKEKFNCCHLATGDMLRSQVAKKTPLGQAAKKIMDAGGLVS 101

Query: 61  DAIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ + +    +C  GFILDG+PRTV QA+ L   +   +  +   +EL+++D  
Sbjct: 102 DEIVIGMIKEELDNNKECKGGFILDGFPRTVPQAEGLDKMLRERNQTLQHAVELKIDDEL 161

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR+E Y K 
Sbjct: 162 LVARITGRLVHP-ASGRSYHVKFNPPKKEMTDDITGEPLIQRSDDNADALKKRLETYHKQ 220

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
             P+ +YY+  G    ID   +  +V +S+ ++    + K S +
Sbjct: 221 TTPVVNYYQKTGIWKAIDASQEPGQVWKSLLAIFDGDKSKASKA 264


>gi|317497074|ref|ZP_07955401.1| adenylate kinase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895619|gb|EFV17774.1| adenylate kinase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 213

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++Q  ++P +STGD+ RA +   T LGK+ +  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIAQAYDIPHISTGDIFRANIKEGTELGKKAQEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI   DC+ G+ILDG+PRT+ QA +L   ++     I+  I++ V D ++
Sbjct: 61  DELVCDLVVDRIHKDDCEKGYILDGFPRTIPQANALDEALAKDGEKIEFAIDIEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +    E  +R DDK +   KR++ Y +   
Sbjct: 121 INRMSGRRSCKDCGAIFHVQYNPPKKENCCDVCGGELILRDDDKAETVKKRLDVYHEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL ++Y++ G L+ IDG  D+  V   I S+L
Sbjct: 181 PLIAHYKEAGSLHEIDGTQDIKVVFEEIKSIL 212


>gi|170755733|ref|YP_001783100.1| adenylate kinase [Clostridium botulinum B1 str. Okra]
 gi|226741866|sp|B1IGD3|KAD_CLOBK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|169120945|gb|ACA44781.1| adenylate kinase [Clostridium botulinum B1 str. Okra]
          Length = 216

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S+K ++P +STGD+ RA +   T LG + K  +++G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAKLISEKFSIPHISTGDIFRANIKEKTPLGIEAKRYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKELDVALLIKVPEGFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   ++EV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESINEVFGNISNIL 212


>gi|116754798|ref|YP_843916.1| adenylate kinases [Methanosaeta thermophila PT]
 gi|121693062|sp|A0B9A2|KAD_METTP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|116666249|gb|ABK15276.1| Adenylate kinase [Methanosaeta thermophila PT]
          Length = 215

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 115/211 (54%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ LGPPGSGKGTQA  +++K NV  +STGD+LR  V   T LGK+ K  M++G L+ 
Sbjct: 1   MNIVLLGPPGSGKGTQAKMIAEKFNVKHISTGDILREHVRNGTELGKEAKKYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+I+  ++ DR+  PD   G++LDGYPRT+ QA++L   +  +   ID V+ + V D  +
Sbjct: 61  DSILIGIIKDRLSKPDVAGGYMLDGYPRTIPQAEALDKILPELKQKIDVVLNIDVPDEEL 120

Query: 121 FKRIQVRVL--------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
            +R+  R +                    +    E   R DDK +  L R++ Y++   P
Sbjct: 121 VRRLSGRRMCKCGRSYHIIFNPPKVPGKCDECGGELYHRDDDKEEAILNRLKVYKQQTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY   G +  I+G  +++++   I  +L
Sbjct: 181 LIDYYTKAGLIANINGAGEINQIFDEISKVL 211


>gi|285017563|ref|YP_003375274.1| adenylate kinase [Xanthomonas albilineans GPE PC73]
 gi|283472781|emb|CBA15286.1| probable adenylate kinase protein [Xanthomonas albilineans]
          Length = 187

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 6/183 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL   L +P +STGD+LRAEV   T LG Q K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQAARLKDTLQIPHISTGDLLRAEVAAGTPLGVQAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D  +GFILDGYPR + QA +L   ++ +   + AV++L V    +
Sbjct: 61  DDILLGMLASRLSREDVRNGFILDGYPRNLAQAGALDELLAKLGQPLGAVVQLDVATDLL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD      KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPASVRKRLQVYNDSTAPVIGFYDKRGTLARVDGVGSL 174

Query: 181 DEV 183
           DEV
Sbjct: 175 DEV 177


>gi|312899064|ref|ZP_07758448.1| adenylate kinase [Megasphaera micronuciformis F0359]
 gi|310619849|gb|EFQ03425.1| adenylate kinase [Megasphaera micronuciformis F0359]
          Length = 211

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 106/203 (52%), Gaps = 21/203 (10%)

Query: 6   LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVN 65
           +GPPG+GKGTQA RL +K  +PQ+STGDM RA V   T LG + K  M++G L+ DA+  
Sbjct: 1   MGPPGAGKGTQAERLIEKYGIPQISTGDMFRAAVKEQTPLGLEAKKYMDNGQLVPDAVTI 60

Query: 66  QVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ 125
            +V +R+   DC  GFILDG+PRT  QA SL A +S++   +D VI + V D  + +R  
Sbjct: 61  GIVRERLAKDDCKKGFILDGFPRTTSQAVSLDAILSDLGIKLDGVINIAVPDEELVRRTT 120

Query: 126 VRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            R++                     +    E   R DDK +   KR+  Y     PL  Y
Sbjct: 121 GRLICRSCGATYHLTSKPPKENGVCDKDGGELYQRDDDKMETVKKRLAVYAAQTKPLIDY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSI 187
           Y+       +DG  DMD V  +I
Sbjct: 181 YKSSNLYIEVDGQQDMDSVFNAI 203


>gi|169823873|ref|YP_001691484.1| adenylate kinase [Finegoldia magna ATCC 29328]
 gi|303234761|ref|ZP_07321387.1| adenylate kinase [Finegoldia magna BVS033A4]
 gi|226743877|sp|B0RZT0|KAD_FINM2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|167830678|dbj|BAG07594.1| adenylate kinase [Finegoldia magna ATCC 29328]
 gi|302494102|gb|EFL53882.1| adenylate kinase [Finegoldia magna BVS033A4]
          Length = 215

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 115/208 (55%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ ++ ++P +STGD+ R  +   T LG++V+G +  G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAKRVIEEFDIPHISTGDIFRKNIKEKTELGQKVEGLLAQGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GF+LDG+PRT+ QA++L   ++     +D V+ + V+  S+
Sbjct: 61  DELTIEIVWDRLDQEDCKNGFLLDGFPRTIPQAEALDEGLAKRGLKLDRVLNIDVDKDSL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + +A  +    R DDK +  L RI+ Y     
Sbjct: 121 VKRLSGRRVCPSCGASYHIDNNPTKVDGICDACQTPVIQREDDKEETVLDRIKVYDSQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     ++ +DG L +DE++  +
Sbjct: 181 PLVDFYNKQDLVFTVDGTLPIDEITNKL 208


>gi|297159618|gb|ADI09330.1| adenylate kinase [Streptomyces bingchenggensis BCW-1]
          Length = 218

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LG+Q +  M +G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAKNLSIPHISTGDLFRANISQGTPLGRQAQDYMRAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+R PD   GF+LDG+PR + QA++L  F+     ++DAV++L V +  +
Sbjct: 61  DEVTIGMAEDRMRQPDAAPGFLLDGFPRNLAQAEALDEFLRENQISLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            +RI  R                      V +    E   R DD  +   KR+E Y +  
Sbjct: 121 VRRIAGRRICRNDSSHVFHVTGAPPKTEGVCDECGGELYQREDDSEETVRKRLEVYHRET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G +  I  +  + EV+ R++D L
Sbjct: 181 EPIIDYYKAKGQVVTIPALGKVSEVTQRAMDVL 213


>gi|78045051|ref|YP_360174.1| adenylate kinase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123576236|sp|Q3ACG0|KAD_CARHZ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|77997166|gb|ABB16065.1| adenylate kinase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 214

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 111/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +GPPG+GKGTQA ++ ++  +  +STGDM RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKLLIMGPPGAGKGTQAEKIVKEFGITHISTGDMFRAALKNQTPLGLKAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V +RI  PDC  GF+LDG+PRT+ QA++L   ++ M   +D VI + V    +
Sbjct: 61  DEIVIAMVEERISAPDCAKGFLLDGFPRTIPQAEALDKKLAEMGITLDGVINIEVPREEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +A   E   RSDD  +    R++ Y     
Sbjct: 121 IERLTGRRVCRQCGATYHVKFNPPKVEGVCDACGGELYQRSDDSLETVSNRLDVYEAQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  IDG   ++EV  SI + L
Sbjct: 181 PLKDYYAKTGLLKNIDGTKSIEEVFASIKNAL 212


>gi|194885988|ref|XP_001976526.1| GG22922 [Drosophila erecta]
 gi|224493073|sp|B3NQ53|KAD2_DROER RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|190659713|gb|EDV56926.1| GG22922 [Drosophila erecta]
          Length = 240

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 115/213 (53%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPGSGKGTQA  L +K  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 22  ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDEL 81

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C +GF+LDG+PRTV QA+ L   +      +DAVIE  ++D  + +R
Sbjct: 82  VVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDNLLVRR 141

Query: 124 IQVRVL----------EAIASEKSV-----------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++          E    +KS+           RSDD  +   KR+E Y K   PL 
Sbjct: 142 ITGRLIHQASGRSYHEEFAPPKKSMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTRPLV 201

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G  + +D      +V  +ID++    R
Sbjct: 202 DYYGLRGLHFKVDAAKKSSDVFSAIDNIFQRKR 234


>gi|220935876|ref|YP_002514775.1| Adenylate kinase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997186|gb|ACL73788.1| Adenylate kinase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 423

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 114/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LG PGSGKGTQA  + ++  VPQ+STGD+LR+ V   T LG+Q K +M++G L+ 
Sbjct: 1   MRIVLLGAPGSGKGTQAKHMVERYRVPQISTGDLLRSAVTAGTPLGQQAKAAMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+ +PD D+GFILDG+PR + QA++L   +  M   +D  + + V+   +
Sbjct: 61  DEIVLGMIRERLAMPDADAGFILDGFPRNISQAEALDRMLEEMGRPLDGTLLIDVDFDLL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +        R+DD  +    R+  Y     
Sbjct: 121 MQRLSGRLTCESCGAVFNRYTKPPRHDTVCDMCGGNLHHRADDNEETISNRLRVYEAQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL SYY+  G L  IDG  ++DE+ +++
Sbjct: 181 PLVSYYQSRGVLETIDGEGEIDEIFQAV 208


>gi|187776597|ref|ZP_02993070.1| hypothetical protein CLOSPO_00111 [Clostridium sporogenes ATCC
           15579]
 gi|187775256|gb|EDU39058.1| hypothetical protein CLOSPO_00111 [Clostridium sporogenes ATCC
           15579]
          Length = 216

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ RA +   T LG + K  +++G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAKLISEKFSIPHISTGDIFRANIKEKTPLGIEAKRYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKDLDVALLIKVPEEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   +DEV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESIDEVFGNISNIL 212


>gi|256027727|ref|ZP_05441561.1| adenylate kinase [Fusobacterium sp. D11]
          Length = 208

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 1   MNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   +  +   I+ VI L V D  +
Sbjct: 61  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILKKLGKQIEKVIALNVPDKDI 120

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 121 IERITGRRTSKVTGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 181 YKAQNKVTEIDGTKKLEDITQDIFKIL 207


>gi|317054787|ref|YP_004103254.1| adenylate kinase [Ruminococcus albus 7]
 gi|315447056|gb|ADU20620.1| adenylate kinase [Ruminococcus albus 7]
          Length = 211

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 115/210 (54%), Gaps = 25/210 (11%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II LG PG+GKGTQA  + ++LN+P +STG+MLRA V   T  G + K +M++G+L+SD 
Sbjct: 4   IILLGAPGAGKGTQAENICKELNIPTISTGNMLRAAVKAGTEYGLKAKAAMDAGALVSDD 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI  PD  +GFILDG+PR+V QA++L A    M   ID VIE+ V D ++ +
Sbjct: 64  IVIGILKDRIAEPDAQNGFILDGFPRSVPQAEALDA----MGVQIDKVIEIDVADETIQQ 119

Query: 123 RIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPL 161
           R+  R                     V +       +R DD+      R+E Y KT  PL
Sbjct: 120 RLSGRRVCLDCGATYHVDFKPSKVEGVCDVCGKPIVIRKDDEPATVKSRLETYHKTTEPL 179

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             YY   G L  + G   ++E S ++ + L
Sbjct: 180 KGYYEKQGKLTSVKGRETVEETSAAVMAAL 209


>gi|296327910|ref|ZP_06870445.1| adenylate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
 gi|296154866|gb|EFG95648.1| adenylate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
          Length = 211

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   LNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V D  +
Sbjct: 64  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILTKLGKQIEKVIALNVPDKDI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    I              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKITGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITQDIFKIL 210


>gi|83591255|ref|YP_431264.1| adenylate kinase [Moorella thermoacetica ATCC 39073]
 gi|123523766|sp|Q2RFR8|KAD_MOOTA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|83574169|gb|ABC20721.1| Adenylate kinase [Moorella thermoacetica ATCC 39073]
          Length = 217

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 124/215 (57%), Gaps = 28/215 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  ++Q+L +P +STGDM R  + R T LG+Q +  ++ G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAREINQRLAIPHISTGDMFREAIKRGTPLGRQAEVYIKGGRLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC +GF+LDG+PRTV QA++L +++S+    +DAVI++ V   ++
Sbjct: 61  DEVTIGLVQERLVQPDCRNGFLLDGFPRTVAQAEALDSWLSSRGERLDAVIDIEVPRDAL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +A   +   R+DD      KR++ Y +   
Sbjct: 121 LERLTGRRVCRQCGATYHVRYNPPAVPGKCDACGQDLVQRADDTEATVNKRLDVYNEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL +YYR  G L  IDG       S++I ++++++
Sbjct: 181 PLVNYYRQRGLLKEIDG-------SQAIPAVILAI 208


>gi|311896543|dbj|BAJ28951.1| putative adenylate kinase [Kitasatospora setae KM-6054]
          Length = 219

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 116/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LG + K  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAHVLAKTLSIPHISTGDLFRANISQGTPLGVEAKSYMDAGRLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  +GF+LDG+PR + QA++L A ++    A+D V++L V +  +
Sbjct: 61  DEVTIGMAKDRMLQPDAANGFLLDGFPRNLGQAEALDAILAENGIALDGVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   RSDD  +    R+E Y    
Sbjct: 121 VKRIAGRRLCRNDGAHVFHVVYNPPKTEGVCDECGGELYQRSDDTEEAVRVRLEEYHSKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G L  I  +  +DEV+ R++ +L
Sbjct: 181 EPIIGYYQQQGLLVTISALGKVDEVTERAVAAL 213


>gi|312135476|ref|YP_004002814.1| adenylate kinase [Caldicellulosiruptor owensensis OL]
 gi|311775527|gb|ADQ05014.1| adenylate kinase [Caldicellulosiruptor owensensis OL]
          Length = 215

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS++ ++P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEYLSKRFSIPHISTGDILRENVKNETELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V DRI   DC +GF+LDG+PRT+ QA++L   +  +   ID V+ + V D  +
Sbjct: 61  DEIVIEIVKDRIAKEDCKNGFLLDGFPRTIAQAEALDRVLQELGQKIDKVLNIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    E   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKNCGASFHIIYRPPQKEGICDICGGELYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+  G L +  G  ++ + ++ +
Sbjct: 181 PLIDYYKAKGLLVVAYGQEEIADTTKEV 208


>gi|34763306|ref|ZP_00144263.1| Adenylate kinase [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|237742293|ref|ZP_04572774.1| adenylate kinase [Fusobacterium sp. 4_1_13]
 gi|256845572|ref|ZP_05551030.1| adenylate kinase [Fusobacterium sp. 3_1_36A2]
 gi|27887029|gb|EAA24144.1| Adenylate kinase [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|229429941|gb|EEO40153.1| adenylate kinase [Fusobacterium sp. 4_1_13]
 gi|256719131|gb|EEU32686.1| adenylate kinase [Fusobacterium sp. 3_1_36A2]
          Length = 211

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   LNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V D  +
Sbjct: 64  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILTKLGKQIEKVIALNVPDKDI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITKDIFKIL 210


>gi|157737030|ref|YP_001489713.1| adenylate kinase [Arcobacter butzleri RM4018]
 gi|157698884|gb|ABV67044.1| adenylate kinase [Arcobacter butzleri RM4018]
          Length = 213

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 111/205 (54%), Gaps = 21/205 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  L +K N+PQ+STGD+LRA +   T +G + K  M++G L+ 
Sbjct: 1   MNLMLFGAPGAGKGTQAKFLIEKYNIPQISTGDILRAAIADKTDMGMEAKKFMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC +GFILDG+PRT+ QA++L   +S+M  ++D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLAEADCKNGFILDGFPRTLAQAEALSELMSSMKISLDKVISLNVPDELI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R                     V +    E  +R DD     + R++ Y     
Sbjct: 121 VGRITGRRVCSKCGASFHVEFNPSKEENVCDYCGGELIIRKDDNAQTVISRLDAYHTQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS 184
           PL  +Y+ MG    +DG  D+ EV+
Sbjct: 181 PLIDFYKKMGVFMELDGTKDVSEVT 205


>gi|118579140|ref|YP_900390.1| adenylate kinases [Pelobacter propionicus DSM 2379]
 gi|166219993|sp|A1ALW2|KAD_PELPD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|118501850|gb|ABK98332.1| Adenylate kinase [Pelobacter propionicus DSM 2379]
          Length = 220

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 116/220 (52%), Gaps = 21/220 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPPG+GKGTQA  + ++  +PQ+STGDMLRA V   T LG + K  M++G L+S
Sbjct: 1   MNVILFGPPGAGKGTQAQYVVERFGIPQISTGDMLRAAVKNCTPLGLKAKEIMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V DR+   DC +GF+LDG+PRT+ QA++L   ++ +    D VI L V +  +
Sbjct: 61  DEIVLGIVADRLSCEDCGTGFVLDGFPRTIPQAEALIEILACLGKQTDHVISLEVSNDEI 120

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
            +R+  R           VL A   +  V          R DD  +    R+  Y K   
Sbjct: 121 TRRLSGRRTCPSCGKGFHVLFAPPRKAGVCDFCGADLVQRGDDHPESICNRLSVYEKQTS 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCS 199
           PL ++Y   G L  +DG L ++++   I  +L      C+
Sbjct: 181 PLKAFYAQKGLLRAVDGSLPVEQIQLQIRKVLEGCSSDCA 220


>gi|160902235|ref|YP_001567816.1| nucleoside-triphosphate--adenylate kinase [Petrotoga mobilis SJ95]
 gi|189028358|sp|A9BFZ7|KAD_PETMO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|160359879|gb|ABX31493.1| Nucleoside-triphosphate--adenylate kinase [Petrotoga mobilis SJ95]
          Length = 215

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 24/218 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++F GPPG+GKGTQA +++Q+  +  +STGD+LR  V + T LGK  K  M+ G L+S
Sbjct: 1   MRLLFFGPPGAGKGTQAKKVAQEFQIVHISTGDILRDAVSKGTELGKMAKAIMDRGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+N +V +  RL + DS FILDGYPRT+DQAK L      +   IDA + + V +  +
Sbjct: 61  DEIMNSLVKE--RLEELDS-FILDGYPRTLDQAKFLDQATKELQKEIDAAVLIDVSEEEI 117

Query: 121 FKRIQVR-------------VLEAIASEKS--------VRSDDKYDVFLKRIENYRKTIL 159
            KRI  R              L+    EK          R DDK +V  +R + Y+K   
Sbjct: 118 VKRISNRRVCPNCGKVYNLITLQPKEDEKCDVCGTKLIQRDDDKEEVVRERYKVYKKNTE 177

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           P+  YYR    +  IDG  ++++V++ + ++L S  K+
Sbjct: 178 PVIEYYRKNNKIITIDGAQNVEDVTKELFNILRSFNKQ 215


>gi|153940386|ref|YP_001392813.1| adenylate kinase [Clostridium botulinum F str. Langeland]
 gi|166219983|sp|A7GJ53|KAD_CLOBL RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|152936282|gb|ABS41780.1| adenylate kinase [Clostridium botulinum F str. Langeland]
 gi|295320793|gb|ADG01171.1| adenylate kinase [Clostridium botulinum F str. 230613]
          Length = 216

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S+K ++P +STGD+ RA +   T LG + K  +++G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAKLISEKFSIPHISTGDIFRANIKEKTPLGIEAKRYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKELDVALLIKVPEEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   ++EV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESINEVFGNISNIL 212


>gi|291518026|emb|CBK73247.1| Adenylate kinase [Butyrivibrio fibrisolvens 16/4]
          Length = 214

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIAAKYSIPHISTGDIFRANIKNGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   D  +GF+LDG+PRT+ QA++L A ++ +  A+D  I++ V D ++
Sbjct: 61  DELTCDLVMDRIAQDDAKNGFVLDGFPRTIPQAEALDAALTKIGQAMDFAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V ++  SE  +R DDK +   KR++ Y     
Sbjct: 121 INRMSGRRACLNCGATYHIVSIPPKKEGVCDSCGSELVLRDDDKPETVKKRLDVYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG   M++V   I ++L
Sbjct: 181 PLIDYYSGKGILKSVDGTQPMEKVFEDITAIL 212


>gi|159046094|ref|YP_001534888.1| adenylate kinase [Dinoroseobacter shibae DFL 12]
 gi|157913854|gb|ABV95287.1| adenylate kinase [Dinoroseobacter shibae DFL 12]
          Length = 229

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 116/216 (53%), Gaps = 22/216 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  G++ K  ME+G+L+S
Sbjct: 12  VNVILLGPPGAGKGTQARMLEEKFGLIQLSTGDLLRAAVAAGTEAGREAKAVMEAGALVS 71

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ DR+   D  +G ILDG+PRT  QA++L A +S+    IDA I L V+D +M
Sbjct: 72  DEIVLAILKDRLAEGDVKAGVILDGFPRTTAQAEALDALLSDAGQGIDAAIALVVDDEAM 131

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                        +  +++ + R+DD  D   +R++ Y    
Sbjct: 132 VGRISGRFTCGGCGEGYHDTFKVPAKSGTCDKCGSTDMTRRADDNADTVRERLKAYHVQT 191

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
            PL  YY   G L  +D M ++  V+  +  ++ S 
Sbjct: 192 APLIGYYEAQGVLRKVDAMGEIGIVAEQLAGIVGSA 227


>gi|297571914|ref|YP_003697688.1| adenylate kinase [Arcanobacterium haemolyticum DSM 20595]
 gi|296932261|gb|ADH93069.1| adenylate kinase [Arcanobacterium haemolyticum DSM 20595]
          Length = 194

 Score =  137 bits (345), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 112/187 (59%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
            R+I  GPPG+GKGTQA  +SQ+L +P +STG++ RAE+   + +G + +  +  G+L+ 
Sbjct: 3   FRLILAGPPGAGKGTQATTVSQQLGIPAISTGEIFRAEIANKSDIGLEAQRYISEGNLVP 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++ N++V  R+  PD  +GF+LDGYPRT++Q  +L A ++    +IDA++++ + D  +
Sbjct: 63  DSVTNEIVRRRLARPDAVNGFLLDGYPRTLEQIDALEAMLAEDGLSIDAMVDIEIPDEEV 122

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      +E   R+DD  +V   R++ Y     P+   +RD   L  IDGM  +
Sbjct: 123 EGRLLKR------AEIEGRADDTPEVIAHRVKVYHDATEPIIGAFRDRNKLITIDGMGTI 176

Query: 181 DEVSRSI 187
           +EV   I
Sbjct: 177 EEVRERI 183


>gi|16804649|ref|NP_466134.1| adenylate kinase [Listeria monocytogenes EGD-e]
 gi|47097182|ref|ZP_00234747.1| adenylate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|224499284|ref|ZP_03667633.1| adenylate kinase [Listeria monocytogenes Finland 1988]
 gi|224503595|ref|ZP_03671902.1| adenylate kinase [Listeria monocytogenes FSL R2-561]
 gi|254830957|ref|ZP_05235612.1| adenylate kinase [Listeria monocytogenes 10403S]
 gi|254899938|ref|ZP_05259862.1| adenylate kinase [Listeria monocytogenes J0161]
 gi|254912856|ref|ZP_05262868.1| adk [Listeria monocytogenes J2818]
 gi|254937236|ref|ZP_05268933.1| adk [Listeria monocytogenes F6900]
 gi|255017192|ref|ZP_05289318.1| adenylate kinase [Listeria monocytogenes FSL F2-515]
 gi|255026521|ref|ZP_05298507.1| adenylate kinase [Listeria monocytogenes FSL J2-003]
 gi|284800503|ref|YP_003412368.1| hypothetical protein LM5578_0249 [Listeria monocytogenes 08-5578]
 gi|284993689|ref|YP_003415457.1| hypothetical protein LM5923_0249 [Listeria monocytogenes 08-5923]
 gi|20138472|sp|Q8Y449|KAD_LISMO RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|16412099|emb|CAD00689.1| adk [Listeria monocytogenes EGD-e]
 gi|47014441|gb|EAL05409.1| adenylate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|258609842|gb|EEW22450.1| adk [Listeria monocytogenes F6900]
 gi|284056065|gb|ADB67006.1| hypothetical protein LM5578_0249 [Listeria monocytogenes 08-5578]
 gi|284059156|gb|ADB70095.1| hypothetical protein LM5923_0249 [Listeria monocytogenes 08-5923]
 gi|293590855|gb|EFF99189.1| adk [Listeria monocytogenes J2818]
          Length = 215

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 118/214 (55%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LG++ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGRKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D   GF+LDG+PRTV+QA+ L   +S++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLSEDDAKDGFLLDGFPRTVEQAQELENILSDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +   KR+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y + G L+ I+G  ++ +V   ++ +L S
Sbjct: 181 PLLDFYSEKGKLHNINGEQEIKDVFVDVEKILAS 214


>gi|325678629|ref|ZP_08158239.1| adenylate kinase [Ruminococcus albus 8]
 gi|324109679|gb|EGC03885.1| adenylate kinase [Ruminococcus albus 8]
          Length = 211

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 115/210 (54%), Gaps = 25/210 (11%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           II LG PG+GKGTQA  + ++LN+P +STG+MLRA V   T  G + K +M++G+L+SD 
Sbjct: 4   IILLGAPGAGKGTQAEVICKELNIPTISTGNMLRAAVKAGTEYGLKAKAAMDAGALVSDD 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI  PD  +GFILDG+PR+V QA++L A    M   ID VIE+ V D ++ K
Sbjct: 64  IVIGILKDRIAEPDAQNGFILDGFPRSVPQAEALDA----MGVQIDKVIEIDVADDTIQK 119

Query: 123 RIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPL 161
           R+  R                     V +       +R DD+      R+E Y KT  PL
Sbjct: 120 RLSGRRVCLDCGATYHVDFKPSKVEGVCDVCGKPIVIRKDDEPATVKSRLETYHKTTEPL 179

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             YY   G L  + G   ++E S ++ + L
Sbjct: 180 KGYYEKQGKLTSVKGRETVEETSAAVMAAL 209


>gi|332021477|gb|EGI61842.1| Adenylate kinase 2, mitochondrial [Acromyrmex echinatior]
          Length = 245

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 111/217 (51%), Gaps = 21/217 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA     +  V  LSTGDMLRAEV   + LG Q+K  M+ G L++D +
Sbjct: 23  VLLGPPGSGKGTQAPLFKDRYCVCHLSTGDMLRAEVSSGSALGTQIKKIMDEGKLVNDDL 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++ + +  P+C  GF+LDG+PR+V QA+ L   +      +DAVIE  +ED  + +R
Sbjct: 83  VVSMIQNNLEKPECKRGFLLDGFPRSVPQAEKLDEMLIKRKTKLDAVIEFGIEDKLLIRR 142

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+  Y     PL 
Sbjct: 143 ITGRLIHPASGRSYHEEFAPPKVPMKDDVTGEPLIKRSDDNEESLKKRLATYHTQTAPLV 202

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCS 199
            YY   G  Y I+     ++V + ID + +   KK S
Sbjct: 203 DYYALQGIHYYINAAQSAEKVFKDIDQIFLKFTKKKS 239


>gi|150020866|ref|YP_001306220.1| adenylate kinase [Thermosipho melanesiensis BI429]
 gi|166220003|sp|A6LLN4|KAD_THEM4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|149793387|gb|ABR30835.1| Adenylate kinase [Thermosipho melanesiensis BI429]
          Length = 214

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+FLGPPG+GKGT A  L + L +P +STGDM R E+   + LG++V+  ++ G L+ 
Sbjct: 1   MNIVFLGPPGAGKGTYAKELKEILGIPHISTGDMFREEISAKSELGRKVEDILKRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PDC  GFILDGYPRTV QAK+L   +  +   +   I   V +  +
Sbjct: 61  DDLTNVIVKERLSKPDCKKGFILDGYPRTVAQAKALDEILKKLGRELKFAIYFEVSEDVV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R +                     +    E   R DD+ +V  +R + Y     
Sbjct: 121 VKRISNRRICKNCGKIYNLITLPPKINGKCDVCGGELYQREDDREEVVRRRYKVYMDNTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           P+  YYR    L+ +DG +D+D V + + +++
Sbjct: 181 PVIEYYRKSNKLFTVDGSMDVDSVIKEVLNII 212


>gi|313801071|gb|EFS42339.1| adenylate kinase [Propionibacterium acnes HL110PA2]
          Length = 189

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 113/193 (58%), Gaps = 6/193 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +G PG+GKGTQA  +++  +VP +STGDM R  +   T LGK+VK  M++G L+ 
Sbjct: 1   MRLLIMGAPGAGKGTQATAIAEHYSVPAISTGDMFRTNIKNGTELGKKVKAIMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + + +V DR+   D  +GF+LDGYPR + Q ++L A++      + AVI L V+   +
Sbjct: 61  DELTDAIVVDRLNQDDAANGFLLDGYPRNMHQVEALDAYLKEHGQRLYAVISLDVDPELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R      +E   R+DD  +    R++ Y     PL  +YR  G L  +DG+ ++
Sbjct: 121 TQRLLKR------AEIEGRTDDNEETIRNRMKVYSSQTEPLLEHYRSAGILVPVDGVGEI 174

Query: 181 DEVSRSIDSLLVS 193
           DEV + I + L S
Sbjct: 175 DEVRQRIFAALDS 187


>gi|184200282|ref|YP_001854489.1| adenylate kinase [Kocuria rhizophila DC2201]
 gi|259494008|sp|B2GJ13|KAD_KOCRD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|183580512|dbj|BAG28983.1| adenylate kinase [Kocuria rhizophila DC2201]
          Length = 188

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 110/186 (59%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA R+S++L VP +STGD+ RA +   T LG++ +   ++G+L+ D
Sbjct: 3   RMLIIGPPGAGKGTQAARISERLGVPAISTGDIFRANIKDQTELGREAQRYTDAGNLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N++V DR+   D   GF+LDGYPRTV Q + L   +      +D V+ L  ++  + 
Sbjct: 63  SVTNEMVRDRLSHEDVSGGFLLDGYPRTVAQVEELDRILEANGVGLDVVLLLTADNDELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      +++  R+DD  DV   R++ Y +   P+   Y D G +  +DG+  +D
Sbjct: 123 SRLLGR------AQEQGRTDDTEDVIRHRLDVYDEQTAPVVGVYEDRGIVVRVDGLGSID 176

Query: 182 EVSRSI 187
            V+  I
Sbjct: 177 HVTERI 182


>gi|315636222|ref|ZP_07891476.1| adenylate kinase [Arcobacter butzleri JV22]
 gi|315479583|gb|EFU70262.1| adenylate kinase [Arcobacter butzleri JV22]
          Length = 213

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 111/205 (54%), Gaps = 21/205 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  G PG+GKGTQA  L +K N+PQ+STGD+LRA +   T +G + K  M++G L+ 
Sbjct: 1   MNLMLFGAPGAGKGTQAKFLIEKYNIPQISTGDILRAAIADKTDMGMEAKKFMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC +GFILDG+PRT+ QA++L   +S+M  ++D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLAESDCKNGFILDGFPRTLAQAEALSELMSSMKISLDKVISLNVPDELI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R                     V +    E  +R DD     + R++ Y     
Sbjct: 121 VGRITGRRVCSKCGASFHVEFNPSKEENVCDYCGGELIIRKDDNAQTVISRLDAYHTQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS 184
           PL  +Y+ MG    +DG  D+ EV+
Sbjct: 181 PLIDFYKKMGVFMELDGTKDVSEVT 205


>gi|325922161|ref|ZP_08183950.1| Adenylate kinase [Xanthomonas gardneri ATCC 19865]
 gi|325547363|gb|EGD18428.1| Adenylate kinase [Xanthomonas gardneri ATCC 19865]
          Length = 187

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 106/191 (55%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFEIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA +L   +  +   +DAV++L V    +
Sbjct: 61  DEILLGMLEARLGQADVAKGFILDGYPRNVAQANALDELLGKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV   I   L
Sbjct: 175 DEVLERISKAL 185


>gi|160872001|ref|ZP_02062133.1| adenylate kinase (ATP-AMP transphosphorylase) [Rickettsiella
           grylli]
 gi|159120800|gb|EDP46138.1| adenylate kinase (ATP-AMP transphosphorylase) [Rickettsiella
           grylli]
          Length = 225

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 126/229 (55%), Gaps = 33/229 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  L++  ++PQ+STGDMLR  V++ T LG QVK  M+ G LIS
Sbjct: 1   MRIILLGPPGAGKGTQAKFLTRYYHIPQISTGDMLRLAVNQRTSLGFQVKTLMDQGQLIS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+ ++V  RI+  DC +GF+ DG+PRT+ QA+++ A        ID VIE++V+D  +
Sbjct: 61  DEIIIKLVESRIQQSDCINGFLFDGFPRTLGQAEAIRA----QRIFIDFVIEIKVDDDEI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                      I  E+ + R DD   +  +R+  Y +   
Sbjct: 117 VKRLSGRRIHPASGRIYHLVYTPPKVANKDDITGEELIQRHDDTEAIIRERLRIYHQQTK 176

Query: 160 PLSSYYRDMG--------CLYIIDGMLDMDEVSRSIDSLLVSVRKKCSS 200
           PL  YY++          C   I G  D+++V + I S L   R+K ++
Sbjct: 177 PLRCYYQEWQNKGEEGFPCYISIHGQADVEDVRQRIFSALKENRQKKTN 225


>gi|115973422|ref|XP_001178566.1| PREDICTED: similar to adenylate kinase 2 [Strongylocentrotus
           purpuratus]
          Length = 243

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 121/216 (56%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++ I LGPPG+GKGTQA +L++K  V  L+TGDMLRA +   + LGK++K  ++SG L+S
Sbjct: 18  IKAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAVIASGSDLGKKLKVVLDSGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++ +++  P+C +GF+LDG+PRTV QA+ L   ++    A+D+V+E  ++D+ +
Sbjct: 78  DELVVEMIDNKLGAPECKNGFLLDGFPRTVVQAEKLDELLTKRKTALDSVVEFGIDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSVRSDDKYDVFLK-RIENYRKTIL 159
            KRI  R++                      +  E  ++  D  +V LK R+E Y K   
Sbjct: 138 VKRITGRLIHKPSGRSYHTEFSPPKKPMTDDVTGEPLIKRSDDNEVTLKTRLEAYHKQTA 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY   G    +D     D V  SI S+    +
Sbjct: 198 PLVDYYSKRGIHQRVDAARAPDAVFASIQSIFAKAQ 233


>gi|294785139|ref|ZP_06750427.1| adenylate kinase [Fusobacterium sp. 3_1_27]
 gi|294486853|gb|EFG34215.1| adenylate kinase [Fusobacterium sp. 3_1_27]
          Length = 211

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   LNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V D  +
Sbjct: 64  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILTKLGKQIEKVIALNVPDKDI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITQDIFKIL 210


>gi|33866618|ref|NP_898177.1| adenylate kinase [Synechococcus sp. WH 8102]
 gi|46396094|sp|Q7U4I1|KAD_SYNPX RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|33633396|emb|CAE08601.1| Adenylate kinase [Synechococcus sp. WH 8102]
          Length = 183

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 112/190 (58%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL     +  LSTGD+LR+EV   T LG++ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCNANGMSHLSTGDLLRSEVAAGTALGQEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  +++      G++LDG+PRTV QA +L   +  +   I+AV+ L ++DA + 
Sbjct: 64  ALVLAIVESQLK-GLSSGGWLLDGFPRTVPQADALEPLLDELKQPIEAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R DD   V   R+E YR+   PL S+YRD G L  ++    ++
Sbjct: 123 ERLLAR----------GRDDDNEAVIRNRLEVYREKTSPLISFYRDKGLLVSVEANGSVE 172

Query: 182 EVSRSIDSLL 191
           E+++ I  +L
Sbjct: 173 EITQRITKVL 182


>gi|241253043|ref|XP_002403785.1| adenylate kinase, putative [Ixodes scapularis]
 gi|215496559|gb|EEC06199.1| adenylate kinase, putative [Ixodes scapularis]
          Length = 252

 Score =  137 bits (344), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 116/216 (53%), Gaps = 23/216 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA  L ++  V  LSTGD+LR+EV   + LG+++K +MESG+L+SD +
Sbjct: 32  VLLGPPGSGKGTQAPLLKEEYCVCHLSTGDLLRSEVRSGSALGQELKATMESGALVSDDV 91

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V ++V   +  P+C +GF+LDG+PRTV QA+ L   +      +D+V E  ++D+ + +R
Sbjct: 92  VVRLVSKSLDAPECRNGFLLDGFPRTVVQAEKLDEMLEKRRTPLDSVAEFSIDDSLLIRR 151

Query: 124 IQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTILPL 161
           I  R L  + S +S                       RSDD  D   KR+E Y K   PL
Sbjct: 152 ITGR-LTHLPSGRSYHEEFNPPKQPMTDDVTGEPLVRRSDDNVDALKKRLEVYHKQTSPL 210

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
             YY+  G    ID  L    V  +I     + + K
Sbjct: 211 VGYYQKRGLHTRIDASLPPKAVFENIRKTFEAAKSK 246


>gi|29831490|ref|NP_826124.1| adenylate kinase [Streptomyces avermitilis MA-4680]
 gi|46396106|sp|Q82DM5|KAD_STRAW RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|29608605|dbj|BAC72659.1| putative adenylate kinase [Streptomyces avermitilis MA-4680]
          Length = 220

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L +P +STGD+ RA + + T LGK  K  M+ G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLGIPHISTGDLFRANISQQTELGKLAKSYMDEGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  +GF+LDG+PR V QA++L   + +    +DAV++L V +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAVNGFLLDGFPRNVKQAEALDEMLKSEGMKLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   +R+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHVSYKPPKQEGVCDVCGGELYQRDDDSEETVRRRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YYR  G +  I  +  ++EV+ R++D+L
Sbjct: 181 EPIIDYYRAQGLVVTISALGPVEEVTQRAMDAL 213


>gi|325926643|ref|ZP_08187957.1| Adenylate kinase [Xanthomonas perforans 91-118]
 gi|325542995|gb|EGD14444.1| Adenylate kinase [Xanthomonas perforans 91-118]
          Length = 187

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 107/191 (56%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL    ++P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFDIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA +L   +  +   +DAV++L V    +
Sbjct: 61  DDILLGMLEARLGQADVTKGFILDGYPRNVAQANALDELLGKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV   I   L
Sbjct: 175 DEVLERISKAL 185


>gi|126654306|ref|ZP_01726076.1| adenylate kinase [Bacillus sp. B14905]
 gi|126589235|gb|EAZ83398.1| adenylate kinase [Bacillus sp. B14905]
          Length = 217

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 117/216 (54%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +G PG+GKGTQA ++ +K  +P +STGDM RA +   T LG Q K  M+ G+L+ 
Sbjct: 1   MNIVLMGLPGAGKGTQADKIVEKYAIPHISTGDMFRAAIKEGTELGLQAKSFMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC+ GF+LDG+PRTV QA++L + ++++  AI+  + ++VE   +
Sbjct: 61  DEVTIGIVRERLAKPDCEKGFLLDGFPRTVPQAEALDSILADLGKAIEHTLNIQVEKDEL 120

Query: 121 FKRIQVR------------VLEAIASEKS---------VRSDDKYDVFLKRIENYRKTIL 159
             R+  R            V    A E            R+DD  +    R+E   K   
Sbjct: 121 IARLSGRRICKTCGASYHLVFNPPAEEGKCDKDGGELYTRADDNPETVANRLEVNMKQAQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y+  G L  IDG  D+++V   +D+LL   R
Sbjct: 181 PLLDFYQLKGVLTNIDGQQDINKVFADLDALLQGSR 216


>gi|114320412|ref|YP_742095.1| adenylate kinase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311856|sp|Q0A982|KAD_ALHEH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|114226806|gb|ABI56605.1| Adenylate kinase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 219

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 119/220 (54%), Gaps = 33/220 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LGPPG+GKGTQA  + ++ ++PQ+STGDMLRA V   T LG+Q K  M++G L+S
Sbjct: 1   MKVILLGPPGAGKGTQAAGICERFDIPQISTGDMLRAAVKAGTPLGQQAKKVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI  PDC +GF+ DG+PRT+ QA+ L A   N    +DAV+E++V D  +
Sbjct: 61  DDIIMGLVKERIAEPDCANGFLFDGFPRTIAQAEGLKAEGIN----VDAVVEIQVPDEDI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                      +  E  V R DD+ +   KR+  Y +   
Sbjct: 117 VQRMAGRRVHPGSGRVYHVEHNPPKEEGKDDVTGEPLVQRDDDQEETVRKRLGVYHEQTQ 176

Query: 160 PLSSYYRDMGC--------LYIIDGMLDMDEVSRSIDSLL 191
           PL  YY D             +I G+  +D++   I S L
Sbjct: 177 PLVEYYSDWAAKGGDGAPRYIVIKGVGSVDDIRNRILSEL 216


>gi|257453249|ref|ZP_05618548.1| adenylate kinase [Fusobacterium sp. 3_1_5R]
 gi|257467156|ref|ZP_05631467.1| adenylate kinase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918287|ref|ZP_07914527.1| adenylate kinase [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059783|ref|ZP_07924268.1| adenylate kinase [Fusobacterium sp. 3_1_5R]
 gi|313685459|gb|EFS22294.1| adenylate kinase [Fusobacterium sp. 3_1_5R]
 gi|313692162|gb|EFS28997.1| adenylate kinase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 210

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  +  +  +PQ+STGD+LR  +   T LG + K  M+ G L+ 
Sbjct: 3   MNIVLFGAPGAGKGTQAKFIMDQYEIPQISTGDILRQAIANKTTLGLEAKKFMDEGKLVP 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++VN +V +R+   DC  GFI+DG+PRTV QA+ L   +  ++  I+ VI L V+D  +
Sbjct: 63  DSVVNGLVAERLEQADCKKGFIMDGFPRTVVQAEELDKILEKLNRKIEKVIALNVKDEDI 122

Query: 121 FKRIQVR----------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                 ++   ++   R+DD  +V  KR+  Y +   P+  Y
Sbjct: 123 VERITGRRTSKKTGKIYHMTFNPPVDEDPADLVQRADDTKEVVEKRLSTYHEQTAPVLDY 182

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   M+E+++ I S+L
Sbjct: 183 YKAQNKVSEIDGSQQMEEITKQIFSIL 209


>gi|114797627|ref|YP_761508.1| adenylate kinase [Hyphomonas neptunium ATCC 15444]
 gi|123128478|sp|Q0BYD5|KAD_HYPNA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|114737801|gb|ABI75926.1| adenylate kinase [Hyphomonas neptunium ATCC 15444]
          Length = 189

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++    QLSTGDMLRA     + LG++V   M+ G L+S
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEQRGFVQLSTGDMLRAARASGSELGQRVAKIMDEGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++ +     GFI DG+PRT+ QA++L + + + +  +D VI + V+D  +
Sbjct: 61  DEIVIALIEEQLTVQAGAPGFIFDGFPRTIGQAEALDSLLESRESKVDLVIRMIVDDTRL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R       E+  R+DD    F +R+E Y +   PL   Y + G L  IDGM  +
Sbjct: 121 LERVTKRF------EEQGRADDNPATFSRRLERYYEDTAPLVPMYAERGVLVEIDGMGSI 174

Query: 181 DEVSRSIDSLL 191
           + VS  ID+ L
Sbjct: 175 EAVSAEIDAAL 185


>gi|295093654|emb|CBK82745.1| Adenylate kinase [Coprococcus sp. ART55/1]
          Length = 214

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  ++ K  VP +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKMIAAKYGVPHISTGDIFRANIKNGTELGAKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR +  DC  G+ILDG+PRT+ QA++L   +S +  ++D  I + V D ++
Sbjct: 61  DELVVDLVIDRFKADDCAKGYILDGFPRTIPQAEALDKALSAIGDSVDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +A  S+  +R DDK +   KR+  Y +   
Sbjct: 121 IERMSGRRACVGCGATYHIVYNPTKVEGKCDACGSDLILRDDDKPETVEKRLNVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  +DG +DM +V  +I  +L
Sbjct: 181 PLIDYYKAKGILKEVDGTVDMKDVFAAITDIL 212


>gi|237740775|ref|ZP_04571256.1| adenylate kinase [Fusobacterium sp. 2_1_31]
 gi|229422792|gb|EEO37839.1| adenylate kinase [Fusobacterium sp. 2_1_31]
          Length = 211

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 115/207 (55%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   VNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANQTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V DA +
Sbjct: 64  DEVVNGLVEERLAEKDCEKGFIMDGFPRTVVQAKALDEILTRLGKQIEKVIALNVPDADI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKEEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITQDIYRIL 210


>gi|326559423|gb|EGE09848.1| adenylate kinase [Moraxella catarrhalis 46P47B1]
 gi|326572458|gb|EGE22450.1| adenylate kinase [Moraxella catarrhalis BC8]
          Length = 219

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 121/221 (54%), Gaps = 32/221 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++  +PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQLISKEFGIPQISTGDMLRAAIKAGTELGKQAKSVMDAGQLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PDCD+G I DG+PRT+ QAK+L    ++   AID VIE+ V D  +
Sbjct: 62  DELIINLVKERLKQPDCDNGCIFDGFPRTIPQAKAL----ADAGIAIDHVIEISVPDDEI 117

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     ++ +  E  V R DDK +V   R+  Y     
Sbjct: 118 VSRMSGRRAHLASGRTYHVIYNPPKTDGIDDVTGEALVQRDDDKEEVVRDRLSVYHAQTA 177

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLLVS 193
            L S+Y+++          +  DG   +D V   I ++L S
Sbjct: 178 TLISHYQEVAKSGENAPEYHDFDGTKSIDTVRDEIFAVLKS 218


>gi|260893101|ref|YP_003239198.1| adenylate kinase [Ammonifex degensii KC4]
 gi|260865242|gb|ACX52348.1| adenylate kinase [Ammonifex degensii KC4]
          Length = 214

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 114/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++ +GPPG+GKGTQ+ RL ++ N+P +STGDMLR  V + T +GK+ K  M+ G L+ 
Sbjct: 1   MNLLIMGPPGAGKGTQSERLVKEFNIPHISTGDMLREAVKQGTEMGKKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  VV +R+  PDC+ GF+LDG+PRTV QA++L   +  M   +DAVI + V    +
Sbjct: 61  DEVIIGVVKERLMQPDCERGFLLDGFPRTVAQAEALDKLLLEMGRKLDAVINVSVPREKI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +                     +    E   RSDD  +   KR++ Y     
Sbjct: 121 VARLTGRRVCKVCGATYHIVNNPPKVEGKCDKCGGELYQRSDDTEETVNKRLDVYEAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  IDG   +D+V   I + L
Sbjct: 181 PLIEYYQAKGLLVNIDGDQPIDKVFADIMAAL 212


>gi|110678451|ref|YP_681458.1| adenylate kinase [Roseobacter denitrificans OCh 114]
 gi|109454567|gb|ABG30772.1| adenylate kinase [Roseobacter denitrificans OCh 114]
          Length = 228

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 116/214 (54%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LRA V   T  G + K  M +G L+SD 
Sbjct: 13  LILLGPPGAGKGTQARMLQEKFGLVQLSTGDLLRAAVAAGTKAGIEAKAVMAAGGLVSDE 72

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV QV+ DR+  PDC +G +LDG+PRT  QA++L   ++     I+A I L V++  M  
Sbjct: 73  IVLQVLADRLCEPDCAAGVVLDGFPRTTGQAEALDQMLAKSGQRINAAIALEVDNVKMVL 132

Query: 123 RIQVR---------------------VLEAIASEK-SVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                     V +   S K + R+DD     + R++ Y++   P
Sbjct: 133 RIAGRFTCADCGEGYHDNFKPTRAEGVCDGCGSTKMTRRADDNAQTVMSRLDAYQEQTEP 192

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY   G L  ++ M D+  +++SI  ++  V
Sbjct: 193 LIAYYDAKGSLRRVNAMGDISAIAQSIAQIVSRV 226


>gi|220930985|ref|YP_002507893.1| Adenylate kinase [Halothermothrix orenii H 168]
 gi|219992295|gb|ACL68898.1| Adenylate kinase [Halothermothrix orenii H 168]
          Length = 216

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ LG PG+GKGTQA ++SQ+ N+P ++TGD+ R  +   T LGK+ K  ++SG L+ 
Sbjct: 1   MNIVLLGLPGAGKGTQAKKMSQEYNLPHIATGDIFRQAIREETPLGKEAKKYLDSGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +V +RI+  DCD+GFILDG+PRT++QA++L   + +M   ID  + ++V++  +
Sbjct: 61  DEITIGIVRERIQKDDCDNGFILDGFPRTLNQARALTGMLEDMGRKIDVALYIKVKEEEL 120

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
            KR+  R           V+     E+ +          RSDDK +    RI   ++ + 
Sbjct: 121 IKRLSGRRVCQECGAAYHVVYNPPKEEGICDLCKGKLIQRSDDKEETVKNRIRINKEKME 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            L  YYR+ G L  ++    +DEV   I  ++
Sbjct: 181 DLIEYYRNQGNLKTVESTGGIDEVFNKIQEII 212


>gi|294790432|ref|ZP_06755590.1| adenylate kinase (ATP-AMP transphosphorylase) [Scardovia inopinata
           F0304]
 gi|294458329|gb|EFG26682.1| adenylate kinase (ATP-AMP transphosphorylase) [Scardovia inopinata
           F0304]
          Length = 192

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 112/191 (58%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++   +P +STGD+ R  +   T LGK+V+  ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHYQIPAISTGDIFRYNLKNQTDLGKKVQAFIDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N ++ DR+ + D   G+ILDGYPR   Q ++L   ++ ++  +D V+ L+ +   +
Sbjct: 61  DQLTNSIIKDRLAMEDAQQGWILDGYPRNAAQVEALDQMLAELETPLDKVLALQADRQVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      +E   RSDD  DV  +R++ Y K   PL   Y+D G L  I+G+  +
Sbjct: 121 MDRMTKR------AEIEGRSDDTPDVIARRLDVYAKETKPLLDIYKDRGLLLEINGVGQI 174

Query: 181 DEVSRSIDSLL 191
           D++S+++ S L
Sbjct: 175 DQISKTVISQL 185


>gi|21244162|ref|NP_643744.1| adenylate kinase [Xanthomonas axonopodis pv. citri str. 306]
 gi|78049109|ref|YP_365284.1| adenylate kinase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|294627150|ref|ZP_06705738.1| adenylate kinase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294666198|ref|ZP_06731452.1| adenylate kinase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|24418465|sp|Q8PH23|KAD_XANAC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123584262|sp|Q3BPM9|KAD_XANC5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|21109795|gb|AAM38280.1| adenylate kinase [Xanthomonas axonopodis pv. citri str. 306]
 gi|78037539|emb|CAJ25284.1| adenylate kinase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|292598583|gb|EFF42732.1| adenylate kinase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604016|gb|EFF47413.1| adenylate kinase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 187

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 107/191 (56%), Gaps = 6/191 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPGSGKGTQA RL    ++P +STGD+LRAEV   + LG + K  M  G L+S
Sbjct: 1   MRLVLLGPPGSGKGTQATRLKDTFDIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++  R+   D   GFILDGYPR V QA +L   +  +   +DAV++L V    +
Sbjct: 61  DDILLGMLEARLGQADVAKGFILDGYPRNVAQANALDELLGKIGQPLDAVVQLDVASELL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +
Sbjct: 121 VERIAGR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLARVDGVGSL 174

Query: 181 DEVSRSIDSLL 191
           DEV   I   L
Sbjct: 175 DEVLERISKAL 185


>gi|302869951|ref|YP_003838588.1| adenylate kinase [Micromonospora aurantiaca ATCC 27029]
 gi|315501412|ref|YP_004080299.1| adenylate kinase [Micromonospora sp. L5]
 gi|302572810|gb|ADL49012.1| adenylate kinase [Micromonospora aurantiaca ATCC 27029]
 gi|315408031|gb|ADU06148.1| adenylate kinase [Micromonospora sp. L5]
          Length = 217

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 118/212 (55%), Gaps = 22/212 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++  L+VP++STGD+ RA V + T LG + K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEFVAAHLSVPKISTGDIFRANVSQGTPLGVEAKRYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+  PD   GF+LDG+PRT  QA +L   ++++  A+D V+EL V+D  +
Sbjct: 61  DEVTINMVRDRLAEPDASEGFLLDGFPRTTPQAAALDKLLADLGTALDLVLELVVDDDEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +   +E   R DDK +    R+  Y +   
Sbjct: 121 IRRLSGRRTCRGCGKIWHVEFDSPSREGVCDRCGAELFQRDDDKPETIAARLREYAEKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
           PL  YY   G L  ID    +++V+ R+ID+L
Sbjct: 181 PLVDYYGAQGKLVGIDATGPVEDVTVRAIDAL 212


>gi|120611230|ref|YP_970908.1| adenylate kinase [Acidovorax citrulli AAC00-1]
 gi|166980289|sp|A1TQ96|KAD_ACIAC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|120589694|gb|ABM33134.1| Adenylate kinase [Acidovorax citrulli AAC00-1]
          Length = 218

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 103/182 (56%), Gaps = 17/182 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG+Q K  M++G L+S
Sbjct: 1   MRLILLGAPGAGKGTQAAFICQKYGIPQISTGDMLRAAVKAGTPLGQQAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V DRI  PDC  GF+ DG+PRT+ QA ++ A      ++  +D   DA+IE  
Sbjct: 61  DDLIINLVKDRIAQPDCAKGFLFDGFPRTIPQADAMKAAGVKLDYVLEIDVPFDAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   +V   + +  E  + R DDK D   KR+E Y     PL  
Sbjct: 121 SGRRSHPASGRTYHVKFNPPKVEGKDDVTGEDLIQREDDKEDTVKKRLEVYSAQTRPLVE 180

Query: 164 YY 165
           YY
Sbjct: 181 YY 182


>gi|326317454|ref|YP_004235126.1| adenylate kinase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374290|gb|ADX46559.1| adenylate kinase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 218

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 103/182 (56%), Gaps = 17/182 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG+Q K  M++G L+S
Sbjct: 1   MRLILLGAPGAGKGTQAAFICQKYGIPQISTGDMLRAAVKAGTPLGQQAKAVMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V DRI  PDC  GF+ DG+PRT+ QA ++ A      ++  +D   DA+IE  
Sbjct: 61  DDLIINLVKDRIAQPDCAKGFLFDGFPRTIPQADAMKAAGVKLDYVLEIDVPFDAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   +V   + +  E  + R DDK D   KR+E Y     PL  
Sbjct: 121 SGRRSHPASGRTYHVKFNPPKVEGKDDVTGEDLIQREDDKEDTVKKRLEVYSAQTRPLVE 180

Query: 164 YY 165
           YY
Sbjct: 181 YY 182


>gi|159026035|emb|CAO88772.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gi|159028186|emb|CAO89793.1| adk1 [Microcystis aeruginosa PCC 7806]
          Length = 188

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 108/190 (56%), Gaps = 10/190 (5%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPGSGKGTQA +L++ L +P +STG++LR  +   T LG+Q +  +E G L+ D 
Sbjct: 7   VIFLGPPGSGKGTQAAKLAESLTIPHISTGEILRQAITEKTELGQQAQAYVEKGELVPDE 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++  ++ +R++ PD   G+ILDG+PRTV QA  L A +  +  +   V+ L V D  + +
Sbjct: 67  LLLGLIQERLKQPDSAKGWILDGFPRTVAQASFLDALLEELADSYTFVVNLAVPDTVLIE 126

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R           R DD  +   +R++ Y     P+  YY   G L  IDG   MD 
Sbjct: 127 RLMQR----------GRQDDTKETISRRLQVYIDQTAPVLDYYGQKGTLNHIDGNQPMDT 176

Query: 183 VSRSIDSLLV 192
           V+ ++ +++ 
Sbjct: 177 VTAALTAVVT 186


>gi|186684491|ref|YP_001867687.1| adenylate kinase [Nostoc punctiforme PCC 73102]
 gi|186466943|gb|ACC82744.1| adenylate kinase [Nostoc punctiforme PCC 73102]
          Length = 183

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IFLGPPG+GKGTQA  L+  LN+P +STG++LR  +   T LG + +  + SG L+ D
Sbjct: 3   RLIFLGPPGAGKGTQAQSLAGHLNIPHISTGEILRQAMKEQTHLGIKAQNYVNSGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V +R+  PD ++G+ILDG+PR V QA  L   +  +  + + V+ L   D  + 
Sbjct: 63  QLVQDLVQERLNQPDAENGWILDGFPRKVTQAAFLEELLETIHQSGERVVNLDAPDDVVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R DD  +V  +R+E YR    PL  YYRD   L  ++G    +
Sbjct: 123 ERLLAR----------GRKDDTEEVIRRRLEVYRAETAPLIDYYRDRQKLLTVNGNQSQE 172

Query: 182 EVSRSIDSLL 191
           EV+  +  ++
Sbjct: 173 EVTTELQKVI 182


>gi|205372049|ref|ZP_03224866.1| adenylate kinase [Bacillus coahuilensis m4-4]
          Length = 215

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 119/215 (55%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA ++ ++  +P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNILLMGPPGAGKGTQAEKIVEEYGIPHISTGDMFRAAIKAGTELGLEAKSYMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+ L DC+ GF+LDG+PRTV QA++L   +S++  +ID VI ++V+   +
Sbjct: 61  DEVTIGIVRERLALADCEKGFLLDGFPRTVAQAEALEQILSDLTKSIDYVINIQVDHDIL 120

Query: 121 FKRIQVR------------VLEAIASEKSV---------RSDDKYDVFLKRIENYRKTIL 159
             R+  R            V    A+E            R+DD  +    R+  Y     
Sbjct: 121 MSRLTGRRICKSCGATYHLVFNPPANEGVCDRCGGDLYQRADDNEETVGNRLAVYTNQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL  +Y++ G L  I+G  D+ +V   IDSL+ S+
Sbjct: 181 PLLDFYQEKGYLKNINGQQDISDVYSDIDSLIGSL 215


>gi|15896362|ref|NP_349711.1| adenylate kinase [Clostridium acetobutylicum ATCC 824]
 gi|20138497|sp|Q97EJ9|KAD_CLOAB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|15026178|gb|AAK81051.1|AE007808_4 Adenylate kinase [Clostridium acetobutylicum ATCC 824]
 gi|325510518|gb|ADZ22154.1| adenylate kinase [Clostridium acetobutylicum EA 2018]
          Length = 215

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LGPPG+GKGTQA  +S + ++P +STGD+ RA +   T LG + KG M+ G L+ 
Sbjct: 1   MKIILLGPPGAGKGTQAKLISSEFSIPHISTGDIFRANISGKTELGMKAKGYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC SGF+LDG+PRTV+QA++L  F+      ID  + + V    +
Sbjct: 61  DELTIDIVKDRISKDDCKSGFLLDGFPRTVNQAEALDKFLVGRKEKIDCALLIDVPREKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
           F R+  R                     + +   S    R DD  D   +R++ Y +   
Sbjct: 121 FNRMTGRRVCSKCGASYHIEYNPTKVEGICDLCGSPVVQRKDDSEDTVKERLDVYDRQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR+   L  +DG  D+D+V   I ++L
Sbjct: 181 PLVVYYRNEAVLKSVDGTQDIDKVFEDIRNVL 212


>gi|146276561|ref|YP_001166720.1| adenylate kinase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554802|gb|ABP69415.1| Adenylate kinase [Rhodobacter sphaeroides ATCC 17025]
          Length = 229

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 107/211 (50%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 14  LILLGPPGAGKGTQARMLEERFGLVQLSTGDLLRAAVAAGTPAGMAAKAVMEAGGLVSDE 73

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV +++ +R+  PD   G ILDG+PRT  QA +L   +      + A I L V+DA+M +
Sbjct: 74  IVLEILAERMAQPDVARGIILDGFPRTAGQAAALDGLLGRTGQRVTAAISLEVDDAAMVE 133

Query: 123 RIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTILP 160
           R+  R   A   E                         R DD  +    R+  Y     P
Sbjct: 134 RVSGRFTCAACGEGYHDHFKQAAVAGTCDKCGGTDFRRRPDDNAETVGARLAAYHAQTAP 193

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L +YY   G L  ID M  +DE++RS+  ++
Sbjct: 194 LIAYYDGCGVLERIDAMGAIDEIARSLGRIV 224


>gi|288923197|ref|ZP_06417340.1| adenylate kinase [Frankia sp. EUN1f]
 gi|288345458|gb|EFC79844.1| adenylate kinase [Frankia sp. EUN1f]
          Length = 199

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 114/195 (58%), Gaps = 7/195 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA R+S +  VP +STG +   ++   T LG++ +  + +G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAARISARHGVPAISTGQLFDQQISAGTSLGRRAERYVRAGELVP 60

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  +V DR+    DC +GF+LDG+PRT+ QA++L   +      +D V++L+V+ A 
Sbjct: 61  DEIVLDIVADRLTTGADCGAGFLLDGFPRTLPQAEALDRMLDASCGPLDVVMDLKVDQAE 120

Query: 120 MFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
           +  RI  R L    SE   R DD  +   +R+E +     PL S+Y + G L  IDG   
Sbjct: 121 VLARISRRAL----SEG--RVDDTAETARRRMEVFTAETAPLRSHYGEQGLLRTIDGSGT 174

Query: 180 MDEVSRSIDSLLVSV 194
            D+V+  I+  L +V
Sbjct: 175 PDDVAARIEEALTAV 189


>gi|160881764|ref|YP_001560732.1| nucleoside-triphosphate--adenylate kinase [Clostridium
           phytofermentans ISDg]
 gi|189046011|sp|A9KJH3|KAD_CLOPH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|160430430|gb|ABX43993.1| Nucleoside-triphosphate--adenylate kinase [Clostridium
           phytofermentans ISDg]
          Length = 217

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 112/215 (52%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K  +P +STGD+ RA +  NT LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAEKYKIPHISTGDIFRANIKNNTELGAKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +V DR    DC +G++LDG+PRT+ QA++L+  +      ID  I + V D  +
Sbjct: 61  DEITLDMVMDRFAQDDCKNGYVLDGFPRTIPQAEALNKALVEEGEQIDYAINIEVPDELI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +A   E ++R DDK +   KR+  Y     
Sbjct: 121 VSRMSGRRACVSCGGTYHVVFTPTKKEGICDACGGELTIRDDDKPETVAKRLNVYHNQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL +YY  +G L  +DG  +  EV   I  +L  V
Sbjct: 181 PLINYYHGLGLLEEVDGTKEALEVFEDIIGILGKV 215


>gi|296133486|ref|YP_003640733.1| adenylate kinase [Thermincola sp. JR]
 gi|296032064|gb|ADG82832.1| adenylate kinase [Thermincola potens JR]
          Length = 214

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 116/217 (53%), Gaps = 24/217 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +GPPG+GKGTQA  L ++LN+  +STGDM RA +   T +GK+ K  M+ G L+ 
Sbjct: 1   MKLMIMGPPGAGKGTQAEVLVKELNITHISTGDMFRAAIKEGTEMGKKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+  PDC+ GF+LDG+PRT+ QA++L   +  M   +D VI + V    +
Sbjct: 61  DEVVVGMVKDRLSQPDCEKGFLLDGFPRTIAQAEALSKTLDEMGIKLDGVINIEVPREKL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V      E   RSDD  +    R++ Y +   
Sbjct: 121 LARLTGRRVCKSCGASYHVLFNPPEKEGVCNNCGGELYQRSDDNEETVNNRLDVYEEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  YY++ G L  I+G   +D+V   +  +L ++RK
Sbjct: 181 PLIDYYKEKGLLININGDQPIDKV---LADILAALRK 214


>gi|227876175|ref|ZP_03994291.1| adenylate kinase [Mobiluncus mulieris ATCC 35243]
 gi|269976918|ref|ZP_06183892.1| adenylate kinase [Mobiluncus mulieris 28-1]
 gi|306819451|ref|ZP_07453158.1| adenylate kinase [Mobiluncus mulieris ATCC 35239]
 gi|227843136|gb|EEJ53329.1| adenylate kinase [Mobiluncus mulieris ATCC 35243]
 gi|269934749|gb|EEZ91309.1| adenylate kinase [Mobiluncus mulieris 28-1]
 gi|304647743|gb|EFM45061.1| adenylate kinase [Mobiluncus mulieris ATCC 35239]
          Length = 192

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 110/197 (55%), Gaps = 6/197 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I +GPPG+GKGT A  +SQ+L VP +STGD+ R      T  GK +   ++ G  + 
Sbjct: 1   MKLIIMGPPGAGKGTHATNISQRLGVPWISTGDIFRHHKAAQTDFGKLIASYIDKGEFVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + +++VCDR+   D   GF+LDGYPR + QA+ L  F+S+    +DA + L V    +
Sbjct: 61  DEVTDRIVCDRLEQADARQGFLLDGYPRNLSQAEVLRKFLSDKSTCLDAALYLEVPPEEV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R +         R+DD  +V   R+E +  +  PL  +Y   G L  IDG+ ++
Sbjct: 121 KQRLLHRAV------VQGRADDTEEVITHRLEVFFNSTKPLLDFYAQEGSLRQIDGVGEI 174

Query: 181 DEVSRSIDSLLVSVRKK 197
            E++  I ++L  +  K
Sbjct: 175 PEIAARISAVLDEIESK 191


>gi|220906738|ref|YP_002482049.1| adenylate kinase [Cyanothece sp. PCC 7425]
 gi|254806984|sp|B8HMS3|KAD_CYAP4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|219863349|gb|ACL43688.1| adenylate kinase [Cyanothece sp. PCC 7425]
          Length = 195

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 109/190 (57%), Gaps = 6/190 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+I  GPPG+GKGTQA  L   L++P +STGD+ RA V   T LG+QV+  ++SG L+ D
Sbjct: 3   RLILFGPPGAGKGTQAKHLVDLLDIPHISTGDIFRAAVRNQTPLGQQVQAYLDSGRLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +   ++ +R+   D   G+ILDG+PRT+ QA++L   +  ++   D V+ L V +  + 
Sbjct: 63  ELTINLIQERLHQSDVQKGWILDGFPRTLAQAEALEKLLHQINQPYDRVLSLTVPEEVLT 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+ +R      +EK  R DD  +V  KR+  Y K   PL  +YR+   L  IDG     
Sbjct: 123 QRLVLR------AEKESRKDDTPEVIQKRLGVYWKDTAPLLDFYRNQQRLATIDGNQPES 176

Query: 182 EVSRSIDSLL 191
           +V+  I  ++
Sbjct: 177 DVTAQIQHIV 186


>gi|329889148|ref|ZP_08267491.1| adenylate kinase [Brevundimonas diminuta ATCC 11568]
 gi|328844449|gb|EGF94013.1| adenylate kinase [Brevundimonas diminuta ATCC 11568]
          Length = 187

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 105/180 (58%), Gaps = 6/180 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPP +GKGTQA RL ++  + QLSTGDMLRA +   + LG +VK  +  G L++
Sbjct: 1   MNLILFGPPAAGKGTQAKRLVEERGMVQLSTGDMLRAAIASGSELGLKVKDVLARGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++  R+   +   G I DG+PRTV QA++L A ++     ID+VI L+V+DA++
Sbjct: 61  DEIVIALIEARLPEAEAAGGAIFDGFPRTVAQAEALDAMLAKRGAQIDSVIRLKVDDAAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  E        R+DD  + F  R+  Y +   PL  YY D G L  +DGM D+
Sbjct: 121 TDRIGKRFAE------QGRADDNPETFKDRLAVYNRQTAPLLPYYTDQGKLTEVDGMGDI 174


>gi|237744160|ref|ZP_04574641.1| adenylate kinase [Fusobacterium sp. 7_1]
 gi|260494254|ref|ZP_05814385.1| adenylate kinase [Fusobacterium sp. 3_1_33]
 gi|289765684|ref|ZP_06525062.1| adenylate kinase [Fusobacterium sp. D11]
 gi|229431389|gb|EEO41601.1| adenylate kinase [Fusobacterium sp. 7_1]
 gi|260198400|gb|EEW95916.1| adenylate kinase [Fusobacterium sp. 3_1_33]
 gi|289717239|gb|EFD81251.1| adenylate kinase [Fusobacterium sp. D11]
          Length = 211

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   LNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   +  +   I+ VI L V D  +
Sbjct: 64  DEVVNGLVAERLAEKDCEKGFIMDGFPRTVVQAKALDEILKKLGKQIEKVIALNVPDKDI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITQDIFKIL 210


>gi|302553563|ref|ZP_07305905.1| adenylate kinase [Streptomyces viridochromogenes DSM 40736]
 gi|302471181|gb|EFL34274.1| adenylate kinase [Streptomyces viridochromogenes DSM 40736]
          Length = 220

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 117/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGK  K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKNLSIPHISTGDLFRANISQQTELGKLAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD ++GF+LDG+PR V QA++L   +   +  +DAV++L V +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAENGFLLDGFPRNVSQAEALDELLETENMQLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +    R+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHVTYKQPAKEGVCDVCGGELYQRDDDSEETVRTRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEV-SRSIDSL 190
            P+  YY+  G +  I  +  +++V +R++++L
Sbjct: 181 EPIIDYYKAQGLVVTISALGKVEDVTTRAMEAL 213


>gi|253577200|ref|ZP_04854520.1| adenylate kinase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843444|gb|EES71472.1| adenylate kinase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 217

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++F+GPPG+GKGTQA  +  +  +P +STGD  R  + + T +G + K  M+ G L+ 
Sbjct: 4   MNLLFMGPPGAGKGTQAETIVNEFGIPHISTGDAFRLAIKQGTPVGMKAKEYMDQGLLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R++ PDC+ GF+LDG+PRT+ QA+SL   + +M   +D VI L+V+   +
Sbjct: 64  DDVTVGIVRERLQQPDCEKGFLLDGFPRTLSQAESLDELLDSMGRKLDHVINLKVDRNKL 123

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    E   RSDD  +    R++ Y     
Sbjct: 124 LARLTGRRICKSCGATYHVIFNPPGQEGVCDKCGGELYQRSDDNEESVGTRLDEYINKTA 183

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y D G L  +DG  ++D VS+ I SLL
Sbjct: 184 PLLKFYEDKGLLRQVDGEQEIDAVSKEIVSLL 215


>gi|241895167|ref|ZP_04782463.1| adenylate kinase [Weissella paramesenteroides ATCC 33313]
 gi|241871473|gb|EER75224.1| adenylate kinase [Weissella paramesenteroides ATCC 33313]
          Length = 189

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 111/195 (56%), Gaps = 10/195 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + I+ LG PG GKGTQA ++ +K N+P +STGDM RA +   T LG + K  M++G+L+ 
Sbjct: 3   LNIMLLGLPGVGKGTQAAKIVEKYNLPHISTGDMFRAAMANETELGLKAKSFMDAGNLVP 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D   GFILDG+PR ++QA +L   +S  D ++DAV+    +   +
Sbjct: 63  DEVTNGIVAERLAEEDTKPGFILDGFPRNLEQAHALEDMLSKEDRSLDAVVYFTADTEVL 122

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R           R+DD  +V   R++   K   P++ YY + G L+ IDG  ++
Sbjct: 123 VDRMMAR----------GRADDTPEVIKNRLDVNGKLTEPIAEYYAEKGILHKIDGAREL 172

Query: 181 DEVSRSIDSLLVSVR 195
           D V   +  LL S++
Sbjct: 173 DVVFADVKKLLDSLK 187


>gi|91772107|ref|YP_564799.1| adenylate kinase [Methanococcoides burtonii DSM 6242]
 gi|121691979|sp|Q12ZS7|KAD_METBU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|91711122|gb|ABE51049.1| Adenylate kinase [Methanococcoides burtonii DSM 6242]
          Length = 215

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 112/207 (54%), Gaps = 20/207 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  GPPG+GKGTQA  L +   +P +STGD+LRA V   T LGK+ KG M+ G L+ 
Sbjct: 1   MNVVLFGPPGAGKGTQAKELDKHYQIPHISTGDILRANVRDGTKLGKEAKGYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  V+ +R+   DC  G++LDGYPRT  QA +L + +  +   ++ V+ + V D  +
Sbjct: 61  DEVLIGVIKNRLAESDCKPGYLLDGYPRTTPQADALSSILVEIGMPLEVVLNIDVADEEL 120

Query: 121 FKRIQVR--------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
             R+  R                    V +A  ++   R DDK DV  +R+++Y++   P
Sbjct: 121 VTRLCGRYVCTCGESYHMKFNPPKKENVCDACGADLYQRDDDKEDVIRQRLDSYKEKTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           L SYY + G L  IDG   +D +   I
Sbjct: 181 LISYYGEKGLLVDIDGTGAIDRIFSDI 207


>gi|291544478|emb|CBL17587.1| Adenylate kinase [Ruminococcus sp. 18P13]
          Length = 210

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 115/206 (55%), Gaps = 25/206 (12%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LG PG+GKGTQA  +S+ L++PQ+STG++LR  V   T  G + K +MESG+L+S
Sbjct: 1   MNLILLGAPGAGKGTQAEVISEALSIPQISTGNILREAVKNGTEFGLKAKAAMESGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI   DC +GFILDG+PRTV QA++L A    M   ID V+E+ V D ++
Sbjct: 61  DEVVIGILKDRIAQDDCKNGFILDGFPRTVPQAEALEA----MGVNIDKVVEIYVPDETI 116

Query: 121 FKRIQV-RVLEAIAS--------------------EKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+   RV E   +                       +R DD+    L+R++ Y +   
Sbjct: 117 SKRLSGRRVCEGCGASYHTDFKPSRVAGKCDKCGGNTVIRKDDEPATVLERLKVYHEQTA 176

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSR 185
           PL  +Y   G L  + G  ++ E S+
Sbjct: 177 PLKDFYAKRGKLETVIGQEEVSETSK 202


>gi|149374696|ref|ZP_01892470.1| adenylate kinase [Marinobacter algicola DG893]
 gi|149361399|gb|EDM49849.1| adenylate kinase [Marinobacter algicola DG893]
          Length = 217

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 108/189 (57%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  ++++  +PQ+STGDMLRA V   + LGKQVK  M SG L+S
Sbjct: 1   MRIIMLGAPGAGKGTQAQFITERFEIPQISTGDMLRAAVKAESDLGKQVKEVMASGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R++ PDC +GF+LDG+PRT+ QA++L     +    ID V+E+ V+D  +
Sbjct: 61  DDIIIALIEERVQQPDCKNGFLLDGFPRTIPQAEAL----KDQGIVIDYVVEIAVDDEEI 116

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   RV E       V                    R DDK +   KR++ Y +   
Sbjct: 117 VSRLSGRRVHEGSGRIYHVKYDPPKTEGKDDETGDALIQREDDKEETVRKRLKIYHEQTA 176

Query: 160 PLSSYYRDM 168
           PL  YY+D 
Sbjct: 177 PLVGYYQDW 185


>gi|148381400|ref|YP_001255941.1| adenylate kinase [Clostridium botulinum A str. ATCC 3502]
 gi|153933772|ref|YP_001385775.1| adenylate kinase [Clostridium botulinum A str. ATCC 19397]
 gi|153937525|ref|YP_001389182.1| adenylate kinase [Clostridium botulinum A str. Hall]
 gi|168178853|ref|ZP_02613517.1| adenylate kinase [Clostridium botulinum NCTC 2916]
 gi|226950912|ref|YP_002806003.1| adenylate kinase [Clostridium botulinum A2 str. Kyoto]
 gi|166219981|sp|A7FZ52|KAD_CLOB1 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166219982|sp|A5I7I5|KAD_CLOBH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806980|sp|C1FMT0|KAD_CLOBJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|148290884|emb|CAL85020.1| adenylate kinase [Clostridium botulinum A str. ATCC 3502]
 gi|152929816|gb|ABS35316.1| adenylate kinase [Clostridium botulinum A str. ATCC 19397]
 gi|152933439|gb|ABS38938.1| adenylate kinase [Clostridium botulinum A str. Hall]
 gi|182670291|gb|EDT82267.1| adenylate kinase [Clostridium botulinum NCTC 2916]
 gi|226843814|gb|ACO86480.1| adenylate kinase [Clostridium botulinum A2 str. Kyoto]
          Length = 216

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++ ++P +STGD+ RA +   T LG + K  +++G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAKLISEEFSIPHISTGDIFRANIKEKTPLGIEAKRYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DCD+GF+LDG+PRTV QA++L  F+  ++  +D  + ++V +  +
Sbjct: 61  DEVTIGIVKDRLTKDDCDNGFLLDGFPRTVAQAEALDEFLKGINKELDVALLIKVPEEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   +E   R DD      +R+E Y K   
Sbjct: 121 LERMTGRRVCTSCGASYHIRFNPPKIEGKCDICDNELIQRKDDTEATVKERLEVYSKQTY 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+D G +  ++G   ++EV  +I ++L
Sbjct: 181 PLINYYKDNGIISEVNGTESINEVFGNISNIL 212


>gi|325282661|ref|YP_004255202.1| Adenylate kinase [Deinococcus proteolyticus MRP]
 gi|324314470|gb|ADY25585.1| Adenylate kinase [Deinococcus proteolyticus MRP]
          Length = 200

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 111/196 (56%), Gaps = 7/196 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPG+GKGTQA RL+    + ++STGD+LR  V R T LG+QV   + +G L+ D 
Sbjct: 9   VIFLGPPGAGKGTQAERLAAAYGLTKVSTGDILRDHVARETALGQQVAPILAAGQLVPDD 68

Query: 63  IVNQVVCDRIRLPDCDSG---FILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           I+  ++ DRI    C       I DG+PRT  QA +L   +  +   + A + L V D  
Sbjct: 69  ILVALIRDRI----CTMEPVRIIFDGFPRTQAQANALDLLLEELGAPVSAAVLLEVPDEE 124

Query: 120 MFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLD 179
           +  RI  R  +A A+ + VRSDD  +V  +R E YR+   PL  +Y+  G L  +DG   
Sbjct: 125 LIGRIVERGRQAAAAGEPVRSDDTEEVARRRQEVYRQETAPLIEHYQRTGRLTEVDGTGT 184

Query: 180 MDEVSRSIDSLLVSVR 195
           MDEV   I+ ++ + R
Sbjct: 185 MDEVYARIEQVISTAR 200


>gi|325964702|ref|YP_004242608.1| adenylate kinase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470789|gb|ADX74474.1| Adenylate kinase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 225

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 102/176 (57%), Gaps = 6/176 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ +GPPGSGKGTQA +L++   +P +STG++ R+ V   T LG Q    ++ G  + 
Sbjct: 30  IRLLIIGPPGSGKGTQAEQLARHFGIPAVSTGEIFRSNVSEETELGNQAASYLDGGDFVP 89

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D   GF+LDGYPRT  Q + L   ++N   A+DAVIEL   DA +
Sbjct: 90  DHLTNALVRDRLVDSDLQEGFLLDGYPRTAPQVQELDTMLANQGFALDAVIELHAPDAVL 149

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDG 176
            +R++ R  +        RSDD  DVF +R++ Y +    + S Y   G L  +DG
Sbjct: 150 EQRMRRRAAD------QGRSDDTVDVFRRRLDLYHRETHEVVSVYAGRGILVSVDG 199


>gi|254474825|ref|ZP_05088211.1| adenylate kinase [Ruegeria sp. R11]
 gi|214029068|gb|EEB69903.1| adenylate kinase [Ruegeria sp. R11]
          Length = 227

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 109/211 (51%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA +L       QLSTGD+LRA V   T  GK  K  M +G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARKLESHFGFVQLSTGDLLRAAVAAGTEAGKAAKAVMAAGGLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC  G ILDG+PRT  QA++L A ++     I+A I L V+DA+M  
Sbjct: 72  IVINILRDRLAEPDCAKGVILDGFPRTTVQAEALDALLAETGQRINAAISLEVDDAAMVA 131

Query: 123 RIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+  R   A                       ++E S R+DD  +    R+  Y     P
Sbjct: 132 RVAGRYTCAKCGEGYHDDFKQPSVAGTCDNCGSTEMSRRADDNAETVGSRLAAYHAQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY     L  ID M ++D ++ ++  ++
Sbjct: 192 LIDYYDGKSVLKRIDAMGEIDAIASAMQQVV 222


>gi|260827397|ref|XP_002608651.1| hypothetical protein BRAFLDRAFT_115743 [Branchiostoma floridae]
 gi|229294003|gb|EEN64661.1| hypothetical protein BRAFLDRAFT_115743 [Branchiostoma floridae]
          Length = 241

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 119/218 (54%), Gaps = 21/218 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LGK++K +M+ G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAVVASGSELGKRLKETMDQGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++ + +  P+C +GF+LDG+PRTV QAK L   +   +  +D+V+E  ++D+ +
Sbjct: 78  DEMVVEMIDNNLDKPECKNGFLLDGFPRTVTQAKKLDDLLDTRESKLDSVVEFGIDDSLL 137

Query: 121 FKRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI                    +V + + +  E  + RSDD  +   KR+E Y     
Sbjct: 138 VRRICGRLIHKPSGRSYHEEFNPPKVDMTDDVTGEPLIRRSDDNAETLTKRLEAYHTQTK 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           PL  YY+       +D     D V  SI ++      K
Sbjct: 198 PLVDYYQKRNLHAKVDAAQSPDIVFASIQAIFAQATSK 235


>gi|88812666|ref|ZP_01127913.1| adenylate kinase [Nitrococcus mobilis Nb-231]
 gi|88790082|gb|EAR21202.1| adenylate kinase [Nitrococcus mobilis Nb-231]
          Length = 218

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 117/220 (53%), Gaps = 33/220 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +   +PQ+STGDMLRA V   T LG++ K  M+SG L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAADVCRSYGIPQISTGDMLRAAVQEGTSLGREAKAVMDSGGLVC 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++ ++V +RI  PDC +GF+ DG+PRT+ QA +L     +    ID VIELR+ED  +
Sbjct: 61  DDLIIELVKERITQPDCANGFLFDGFPRTIAQADALR----DEGVRIDYVIELRLEDEEI 116

Query: 121 FKRI--------QVRVLEAIASEKSV-------------RSDDKYDVFLKRIENYRKTIL 159
            +R+          RV   I +  ++             R DD+ +   +R+  Y +   
Sbjct: 117 VRRLSGRRVHPGSGRVYHRIHNPPTLDDRDDLTGEPLVQRDDDREETVRERLRVYHEQTH 176

Query: 160 PLSSYYRDMGC--------LYIIDGMLDMDEVSRSIDSLL 191
           PL +YY               +IDG   +DE+   I + L
Sbjct: 177 PLVAYYSAWAVQDGSAAPRYLVIDGRGGVDEIQARIQTAL 216


>gi|116075748|ref|ZP_01473007.1| Adenylate kinase, subfamily protein [Synechococcus sp. RS9916]
 gi|116067063|gb|EAU72818.1| Adenylate kinase, subfamily protein [Synechococcus sp. RS9916]
          Length = 185

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 111/192 (57%), Gaps = 11/192 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL ++  +  LSTGD+LRAEV   T LGK+ K  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCEQHGMKHLSTGDLLRAEVAAGTDLGKEAKAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  ++     D G++LDG+PR V QA++L   ++ +   ++AV+ L ++DA + 
Sbjct: 64  ALVLAIVKGQLGAL-GDGGWLLDGFPRNVAQAEALEPLLTEIGQPLEAVVLLELDDAVLM 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R DD  DV   R+E YR    PL  +YR  G L  ++   +++
Sbjct: 123 ERMLSR----------GREDDNEDVIRHRLEVYRDKTAPLIDHYRQKGQLISVEAQGNIE 172

Query: 182 EVSRSIDSLLVS 193
            ++  I   L  
Sbjct: 173 AITDRIQQALTG 184


>gi|115655571|ref|XP_001177617.1| PREDICTED: similar to adenylate kinase 2 isoform 3
           [Strongylocentrotus purpuratus]
 gi|115935129|ref|XP_001178157.1| PREDICTED: similar to adenylate kinase 2 isoform 3
           [Strongylocentrotus purpuratus]
          Length = 243

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 121/216 (56%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++ I LGPPG+GKGTQA +L++K  V  L+TGDMLRA +   + LGK++K  ++SG L+S
Sbjct: 18  IKAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAVIASGSDLGKKLKVVLDSGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++ +++  P+C +GF+LDG+PRTV QA+ L   ++    A+D+V+E  ++D+ +
Sbjct: 78  DELVVEMIDNKLGAPECRNGFLLDGFPRTVVQAEKLDELLTKRKTALDSVVEFGIDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSVRSDDKYDVFLK-RIENYRKTIL 159
            KRI  R++                      +  E  ++  D  +V LK R+E Y K   
Sbjct: 138 VKRITGRLIHKPSGRSYHTEFSPPKKPMTDDVTGEPLIKRSDDNEVTLKTRLEAYHKQTA 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY   G    +D     D V  SI ++    +
Sbjct: 198 PLVDYYSKRGIHQRVDAARAPDAVFASIQTIFAKAQ 233


>gi|330431402|gb|AEC16461.1| adenylate kinase [Gallibacterium anatis UMN179]
          Length = 214

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLRA +   + LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKYGIPQISTGDMLRAAIKAGSDLGKQAKVLMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V DR+  PDC  GF+LDG+PRT+ QA +L A       AID V+E  V D  +
Sbjct: 61  DDLIIALVKDRVAQPDCAKGFLLDGFPRTIPQADALKA----AGIAIDFVLEFDVPDEVI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +    +  +R+DDK +  L R++ Y  T  
Sbjct: 117 VERMSGRRVHQPSGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLKVYHSTTQ 176

Query: 160 PLSSYYR---DMG--CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+   D G    + +DG L +D VS  +  +L
Sbjct: 177 PLVDYYKTEADAGKTAYFRLDGTLTVDAVSAKLAEIL 213


>gi|291007968|ref|ZP_06565941.1| adenylate kinase [Saccharopolyspora erythraea NRRL 2338]
          Length = 183

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 100/167 (59%), Gaps = 10/167 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  LS++L+VP +S+GD+ R  +  NT LG++ K  +++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAAVLSEQLSVPHISSGDLFRYHIGNNTPLGEEAKRYLDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N++V +R+  PD   GF+LDG+PR   QA  L   ++     + AV+E  V +  +
Sbjct: 61  DEITNEMVLERLAEPDAAEGFLLDGFPRNTAQADVLARSLAEKGTELTAVLEFDVPEEEL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
            KR+  R           R+DD  DV  +R++ Y     PL +YYRD
Sbjct: 121 VKRLLGR----------GRADDTEDVIRRRLQVYGSETAPLLNYYRD 157


>gi|313891589|ref|ZP_07825199.1| adenylate kinase [Dialister microaerophilus UPII 345-E]
 gi|329121849|ref|ZP_08250464.1| adenylate kinase [Dialister micraerophilus DSM 19965]
 gi|313120048|gb|EFR43230.1| adenylate kinase [Dialister microaerophilus UPII 345-E]
 gi|327467787|gb|EGF13279.1| adenylate kinase [Dialister micraerophilus DSM 19965]
          Length = 217

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 115/217 (52%), Gaps = 21/217 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA +L +   +PQ+STGDM RA V   T LG + K  M+ G+L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAEKLIRDYGIPQISTGDMFRAAVKAGTALGIEAKSYMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V +R++  DC  G+ILDG+PR  DQA++L   +  +   + +VI ++VE+  +
Sbjct: 61  DSVTIGIVKERLQQEDCKKGWILDGFPRNTDQARALDKILKEIGIKLTSVITIKVENKDL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R++                     +   SE   R+DD      +R+  Y     
Sbjct: 121 IKRICGRMMCKKCGASFHKEFRPPVRENICDNCGSELYQRADDNEATVGQRLAVYESKTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  YY++ G    IDG   M++V + I + L    K
Sbjct: 181 PLIDYYKESGSYCEIDGNQSMEDVYKQIQAALEKASK 217


>gi|294782078|ref|ZP_06747404.1| adenylate kinase [Fusobacterium sp. 1_1_41FAA]
 gi|294480719|gb|EFG28494.1| adenylate kinase [Fusobacterium sp. 1_1_41FAA]
          Length = 211

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   VNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANQTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +VN +V +R+   DC+ GFI+DG+PRTV QAK+L   ++ +   I+ VI L V DA +
Sbjct: 64  DEVVNGLVEERLAEKDCEKGFIMDGFPRTVVQAKALDEILTRLGKQIEKVIALNVPDADI 123

Query: 121 FKRIQVR------------VLEAIASEKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R                   EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKATGKIYHIKFNPPVDEKEEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   +++++  I  +L
Sbjct: 184 YKAQNKVTEIDGTKKLEDITEDIYKIL 210


>gi|237808958|ref|YP_002893398.1| adenylate kinase [Tolumonas auensis DSM 9187]
 gi|259494022|sp|C4L8U2|KAD_TOLAT RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|237501219|gb|ACQ93812.1| adenylate kinase [Tolumonas auensis DSM 9187]
          Length = 214

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L +K  +PQ+STGDMLRA +   T LG Q K  M++G L+S
Sbjct: 1   MRIILLGAPGAGKGTQAQFLMEKYGIPQISTGDMLRAAIKAGTALGLQAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+ L DC +GF+LDG+PRT+ QA ++     N    +D V+E  V D  +
Sbjct: 61  DELIINLVKERVTLEDCKNGFLLDGFPRTIPQADAMKEAGIN----VDFVLEFDVPDEEI 116

Query: 121 FKRIQVRVLEA--------------------IASEK-SVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R + A                    +  E  S+R+DD+     KR++ Y +   
Sbjct: 117 VKRMSGRRVHAGSGRVYHVVFNPPKEEGKDDVTGEALSIRADDEETTVRKRLDIYHQQTE 176

Query: 160 PLSSYYRDMGCL-----YIIDGMLDMDEVSRSIDSLL 191
           PL  YY+    L       IDG   + E+S+ +  LL
Sbjct: 177 PLVGYYKKEAELGNTRYSKIDGTQQVAEISKQLAVLL 213


>gi|226356876|ref|YP_002786616.1| adenylate kinase [Deinococcus deserti VCD115]
 gi|259493995|sp|C1CXE5|KAD_DEIDV RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|226318866|gb|ACO46862.1| putative adenylate kinase [Deinococcus deserti VCD115]
          Length = 197

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 114/186 (61%), Gaps = 11/186 (5%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPG+GKGTQA RL+Q+ ++ ++STGD+LR  V R T LG+QVK  +++G L+ D 
Sbjct: 9   VIFLGPPGAGKGTQAERLAQEQSLTKISTGDILRDHVARGTELGQQVKPILDAGHLVPDE 68

Query: 63  IVNQVVCDRIRLPDCDSGF-----ILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVED 117
           I+  ++ D++      +G      I DG+PRT  QA++L A + ++   + AV  L V D
Sbjct: 69  ILIALIRDKL------AGMRPVRVIFDGFPRTGAQAEALDALLEDLGAPVTAVPLLEVPD 122

Query: 118 ASMFKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGM 177
             +  RI  R  +A A  ++VRSDD  +   +R + YR+   PL  YY   G LY ++G+
Sbjct: 123 QVLIDRIVERGNQAQARGEAVRSDDNEETARRRQQVYREQTQPLIDYYAGRGQLYTVNGV 182

Query: 178 LDMDEV 183
             +DEV
Sbjct: 183 GSLDEV 188


>gi|326576054|gb|EGE25973.1| adenylate kinase [Moraxella catarrhalis O35E]
          Length = 219

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 121/221 (54%), Gaps = 32/221 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++  +PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQLISKEFGIPQISTGDMLRAAIKAGTELGKQAKSVMDAGQLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PDCD+G I DG+PRT+ QAK+L    ++   AID VIE+ V D  +
Sbjct: 62  DELIINLVKERLKQPDCDNGCIFDGFPRTIPQAKAL----ADAGIAIDHVIEISVPDDEI 117

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     ++ +  E  V R DDK +V   R+  Y     
Sbjct: 118 VSRMSGRRAHLASGRTYHVIYNPPKTDGIDDVTGEALVQRDDDKEEVVRDRLSVYHAQTT 177

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLLVS 193
            L ++Y+++          +  DG   +D V   I ++L S
Sbjct: 178 TLINHYQEVAKSGENAPEYHDFDGTKSIDTVRDEIFAVLKS 218


>gi|39973591|ref|XP_368186.1| hypothetical protein MGG_01058 [Magnaporthe oryzae 70-15]
 gi|224493008|sp|A4RD93|KAD1_MAGO7 RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|145017985|gb|EDK02264.1| hypothetical protein MGG_01058 [Magnaporthe oryzae 70-15]
          Length = 276

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 121/224 (54%), Gaps = 24/224 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K +   L+TGDMLR++V + T LG++ K  M+ G L+S
Sbjct: 41  IRMILIGPPGAGKGTQAPKIKEKFSCCHLATGDMLRSQVAKKTPLGREAKKIMDQGGLVS 100

Query: 61  DAIVNQVVCDRIRLP-DCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ + +    +C  GFILDG+PRTV QA+SL A +   +  +   +EL+++DA 
Sbjct: 101 DDIVIGMIKEELDTNVECKGGFILDGFPRTVPQAQSLDAMLQARNQKLQHAVELQIDDAL 160

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR+  Y   
Sbjct: 161 LVARITGRLVHP-ASGRSYHTTFNPPKKAMTDDVTGEPLIQRSDDNADALKKRLATYHSQ 219

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
             P+  YYR  G    ID   +   V +S+ ++     KK SS+
Sbjct: 220 TAPVVDYYRKTGIWKPIDASQEPGTVWKSLLNIFDGDAKKASSA 263


>gi|294340368|emb|CAZ88749.1| Adenylate kinase (ATP-AMP transphosphorylase) (AK) [Thiomonas sp.
           3As]
          Length = 216

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 116/218 (53%), Gaps = 31/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  ++++  +PQ+STGDMLRA V   T LG+Q +  ME+G+L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAAFITERFGIPQISTGDMLRAAVKAGTPLGQQAQKIMEAGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  VV +R+  PDC  GF+LDG+PRT+ QA+ L          ID V+E  V DA +
Sbjct: 61  DEIMLGVVRERLSAPDCAKGFLLDGFPRTIAQAEGLE----QAGIGIDVVLEFDVPDADI 116

Query: 121 FKRIQVRVLE---------AIASEKSV------------RSDDKYDVFLKRIENYRKTIL 159
            +R+  R +          A    K+             R+DD+ D   KR++ Y    L
Sbjct: 117 IERLSGRRVHPASGRTYHLAFNPPKTAGVDDLTGEPLVQRADDQEDTVRKRLDVYHAQTL 176

Query: 160 PLSSYYRDMGC------LYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y +         L  I G+  + EV + I + L
Sbjct: 177 PLVKFYAERMAQPGAPRLVTISGVGPVAEVQQRIFAAL 214


>gi|326559721|gb|EGE10131.1| adenylate kinase [Moraxella catarrhalis 7169]
 gi|326564988|gb|EGE15188.1| adenylate kinase [Moraxella catarrhalis 103P14B1]
 gi|326568140|gb|EGE18224.1| adenylate kinase [Moraxella catarrhalis BC7]
 gi|326568558|gb|EGE18630.1| adenylate kinase [Moraxella catarrhalis BC1]
 gi|326572495|gb|EGE22484.1| adenylate kinase [Moraxella catarrhalis CO72]
 gi|326574090|gb|EGE24038.1| adenylate kinase [Moraxella catarrhalis 101P30B1]
          Length = 219

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 32/221 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++  +PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQLISKEFGIPQISTGDMLRAAIKAGTELGKQAKSVMDAGQLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PDCD+G I DG+PRT+ QAK+L    ++   AID VIE+   D  +
Sbjct: 62  DELIINLVKERLKQPDCDNGCIFDGFPRTIPQAKAL----ADAGIAIDHVIEISAPDDEI 117

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     ++ +  E  V R DDK +V   R+  Y     
Sbjct: 118 VSRMSGRRAHLASGRTYHVIYNPPKTDGIDDVTGEALVQRDDDKEEVVRDRLSVYHAQTT 177

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLLVS 193
            L S+Y+++          +  DG   +D V   I ++L S
Sbjct: 178 TLISHYQEVAKSGENAPEYHDFDGTKSIDTVRDEIFAVLKS 218


>gi|238916286|ref|YP_002929803.1| nucleoside-triphosphate--adenylate kinase [Eubacterium eligens ATCC
           27750]
 gi|259494001|sp|C4Z2V1|KAD_EUBE2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|238871646|gb|ACR71356.1| nucleoside-triphosphate--adenylate kinase [Eubacterium eligens ATCC
           27750]
          Length = 213

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 114/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +  NT LG++ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYAIPHISTGDIFRANIKNNTELGQKAKTYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR +  DC +G++LDG+PRT+ QA++L   +S    ++D  I + V D ++
Sbjct: 61  DELVVDLIMDRFKEADCANGYVLDGFPRTIPQAEALDKALSANGESVDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +A   +  +R DDK +    R+  Y +   
Sbjct: 121 INRMSGRRACVGCGATYHIQFNPTKVEGICDACGEKLILRDDDKPETVKNRLSVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG   MD+V  +I  +L
Sbjct: 181 PLIEYYSGKGVLKEVDGTQPMDDVFAAIVKIL 212


>gi|311111951|ref|YP_003983173.1| adenylate kinase [Rothia dentocariosa ATCC 17931]
 gi|310943445|gb|ADP39739.1| adenylate kinase [Rothia dentocariosa ATCC 17931]
          Length = 187

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 114/186 (61%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA +++++L +P +STGD+ R  +   T LGK+ K  ++SG+L+ D
Sbjct: 3   RLLIIGPPGAGKGTQAVKIAEELKIPAISTGDIFRKNIKEETELGKEAKSYIDSGNLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N +V  R+   D   GF+LDGYPR + Q   L A +++ +  ID V+ L  +D  + 
Sbjct: 63  SVTNNMVRARLDEADVAHGFLLDGYPRNIAQVHELDAILADKNQQIDRVLLLVADDDELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A+E+  R+DD  +V   R++ Y +   PL + YR+ G +  +DG+ ++ 
Sbjct: 123 ARLLNR-----AAEQG-RTDDNEEVIRHRLKVYEEETAPLVAKYRERGIVKEVDGLGEIA 176

Query: 182 EVSRSI 187
           +V+  I
Sbjct: 177 DVTERI 182


>gi|290958130|ref|YP_003489312.1| adenylate kinase [Streptomyces scabiei 87.22]
 gi|260647656|emb|CBG70761.1| adenylate kinase [Streptomyces scabiei 87.22]
          Length = 220

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LGK  K  M+ G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLARNLSIPHISTGDLFRANISKQTELGKLAKSYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+  PD  +GF+LDG+PR V QA++L   + +    +DAV++L V +  +
Sbjct: 61  DEVTIAMAKDRMEQPDAVNGFLLDGFPRNVSQAEALDVTLQDESMNLDAVLDLEVPEEEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +A   E   R DD  +   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHVTYKKPKQDGVCDACGGELYQRDDDSEETVRKRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  YY+  G +  I  +  +++V+ R++++L
Sbjct: 181 EPIIDYYKAQGLVVTITALGPVEDVTQRAMEAL 213


>gi|269955456|ref|YP_003325245.1| adenylate kinase [Xylanimonas cellulosilytica DSM 15894]
 gi|269304137|gb|ACZ29687.1| adenylate kinase [Xylanimonas cellulosilytica DSM 15894]
          Length = 211

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 108/186 (58%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GP GSGKGTQA RL++   +P +STGD+ RA +  NT LG+  +     G L+ D
Sbjct: 23  RLLIMGPQGSGKGTQAARLAEVFEIPAISTGDIFRANIKGNTELGRLAQEYTNKGELVPD 82

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + + +V DR+   D   GFILDGYPR   Q ++L A ++++  ++D VIEL  +   + 
Sbjct: 83  EVTDSMVRDRLGQEDAREGFILDGYPRNAHQVEALDAVLTDLGWSLDGVIELTADRDELL 142

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            RI  R      +E   R+DD  +   +R++ Y +   PL++ Y + G L  +DG+ ++ 
Sbjct: 143 SRIAKR------AELEGRADDTEEAIARRLDIYAEQTAPLTAAYGERGLLVQVDGIGEVA 196

Query: 182 EVSRSI 187
           EV+  I
Sbjct: 197 EVTDRI 202


>gi|73949913|ref|XP_864020.1| PREDICTED: similar to adenylate kinase 2 isoform b isoform 2 [Canis
           familiaris]
          Length = 234

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 78  DEMVVELIEKNLETPQCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  V RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLVRRSDDNEKALKIRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G   +ID     D V  SI
Sbjct: 198 PLVDYYRKRGIHSVIDATQTPDVVFASI 225


>gi|293392498|ref|ZP_06636818.1| adenylate kinase [Serratia odorifera DSM 4582]
 gi|291424900|gb|EFE98109.1| adenylate kinase [Serratia odorifera DSM 4582]
          Length = 214

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAM----KEAGIKVDYVLEFDVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQLTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL +YYR   D G    + I+G   +DEVS  + ++L
Sbjct: 177 PLVAYYRQEADAGNTEYHKINGTRKVDEVSAELATIL 213


>gi|307701192|ref|ZP_07638214.1| adenylate kinase [Mobiluncus mulieris FB024-16]
 gi|307613586|gb|EFN92833.1| adenylate kinase [Mobiluncus mulieris FB024-16]
          Length = 192

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 110/197 (55%), Gaps = 6/197 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I +GPPG+GKGT A  +SQ+L VP +STGD+ R      T  GK +   ++ G  + 
Sbjct: 1   MKLIIMGPPGAGKGTHATNISQRLGVPWISTGDIFRHHKAAQTDFGKLIASYIDKGEFVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + +++VCDR+   D   GF+LDGYPR + QA+ L  F+++    +DA + L V    +
Sbjct: 61  DEVTDRIVCDRLEQADARQGFLLDGYPRNLSQAEVLRKFLTDKSTCLDAALYLEVPPEEV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R +         R+DD  +V   R+E +  +  PL  +Y   G L  IDG+ ++
Sbjct: 121 KQRLLHRAV------VQGRADDTEEVITHRLEVFFNSTKPLLDFYAQEGSLRQIDGVGEI 174

Query: 181 DEVSRSIDSLLVSVRKK 197
            E++  I ++L  +  K
Sbjct: 175 PEIAARISAVLDEIESK 191


>gi|51894189|ref|YP_076880.1| adenylate kinase [Symbiobacterium thermophilum IAM 14863]
 gi|68568763|sp|Q67JW4|KAD_SYMTH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|51857878|dbj|BAD42036.1| Adenylate kinase [Symbiobacterium thermophilum IAM 14863]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 116/216 (53%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L+ +  +P +STGD+ RA + + T LGK  K  +++G  + 
Sbjct: 1   MHIILMGPPGAGKGTQAVLLAGQEGIPHISTGDIFRAHMSQGTPLGKLAKEYVDAGKYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+  PDC  GF+LDGYPRT +QA++L   ++ +  A+DAVI + V D  +
Sbjct: 61  DDVTNAMVRDRLAQPDCKKGFVLDGYPRTPEQARALDEMLAELGLALDAVINIDVPDELL 120

Query: 121 FKR-IQVRVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
            +R +  RV  +  +   V                    RSDD+ +    R+  Y     
Sbjct: 121 VERAVGRRVCRSCGATYHVRFNPPREAGRCDRCGGELYQRSDDQEEKVAVRLNLYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y++ G +  + G   MD+V+  I   + + R
Sbjct: 181 PLLQFYKERGLVRTVRGDQPMDQVTADIKEAVRASR 216


>gi|296136133|ref|YP_003643375.1| adenylate kinase [Thiomonas intermedia K12]
 gi|295796255|gb|ADG31045.1| adenylate kinase [Thiomonas intermedia K12]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 116/218 (53%), Gaps = 31/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  ++++  +PQ+STGDMLRA V   T LG+Q +  ME+G+L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAAFITERFGIPQISTGDMLRAAVKAGTPLGQQAQKIMEAGTLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  VV +R+  PDC  GF+LDG+PRT+ QA+ L          ID V+E  V DA +
Sbjct: 61  DEIMLGVVRERLSAPDCAKGFLLDGFPRTIAQAEGLE----KAGIGIDVVLEFDVPDADI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                      +  E  V R+DD+ D   KR++ Y    L
Sbjct: 117 IERLSGRRVHPASGRTYHLTFNPPKTAGVDDLTGEPLVQRADDQEDTVRKRLDVYHAQTL 176

Query: 160 PLSSYYRDMGC------LYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y +         L  I G+  + EV + I + L
Sbjct: 177 PLVKFYAERMAQPGAPRLVTISGVGPVAEVQQRIFAAL 214


>gi|268324773|emb|CBH38361.1| adenylate kinase [uncultured archaeon]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 114/216 (52%), Gaps = 20/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  GPPGSGKGTQA  L++K  VP +STGD+LR  +   T LG + K  M+ G L+ 
Sbjct: 1   MNIVLFGPPGSGKGTQAKMLAEKYGVPHISTGDILRENLKNETKLGLEAKTYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DR+   DC SGF+LDGYPRT+ QA++L   +S +   +D V+ + V DA +
Sbjct: 61  DDLLIGLIKDRLSQSDCASGFLLDGYPRTLPQAEALSKILSELGKNLDLVLNIDVPDAEL 120

Query: 121 FKRIQVR--------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
            KR+  R                    + +   S+   R DDK +  + R++ Y+    P
Sbjct: 121 LKRLAGRRMCVCGASYHILFNKPKQEGICDLCGSKLYHRDDDKEEAIMNRLDVYKNQTRP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           L   Y   G +  I+G  D+  V   I  +L  +RK
Sbjct: 181 LIDLYTQAGVMLTINGAADIAVVFNEICRMLDDLRK 216


>gi|147919309|ref|YP_686955.1| adenylate kinase [uncultured methanogenic archaeon RC-I]
 gi|121685293|sp|Q0W1W4|KAD_UNCMA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|110622351|emb|CAJ37629.1| adenylate kinase [uncultured methanogenic archaeon RC-I]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+ +  GPPG+GKGTQA  LS++LNVP +STGD+LR  V + T LG + K  M+ G L+ 
Sbjct: 1   MQFVLFGPPGAGKGTQAKFLSEELNVPHISTGDILRENVKKGTALGLKAKSYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DR+  PDC  GF+LDG+PRT+ QA++L   + +++  +D VI + V    +
Sbjct: 61  DNLLIDLIKDRLSQPDCRKGFLLDGFPRTIPQAEALDEILDDINKKLDGVINIDVGSGEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + ++   E   R DDK      R++ Y +   
Sbjct: 121 IRRLSGRRICRSCGASYHLVFNPPKAKDLCDSCGGELYQRDDDKEVAIKNRLDVYVRQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           P+  YY+    L  IDG  ++DEV+  + + +
Sbjct: 181 PVLEYYKKKNLLIDIDGEKEIDEVTADVKAAI 212


>gi|320536813|ref|ZP_08036809.1| adenylate kinase [Treponema phagedenis F0421]
 gi|320146322|gb|EFW37942.1| adenylate kinase [Treponema phagedenis F0421]
          Length = 209

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 114/200 (57%), Gaps = 18/200 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M  IFLGPPG+GKGT A  +S++  +P +STG + R  +   T LGKQVK  M+SG L+S
Sbjct: 1   MNFIFLGPPGAGKGTLATEISKRYQIPHISTGQIFREAIKNQTELGKQVKAVMDSGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIEL-RVEDAS 119
           D++   +V +R+  PD   GFILDG+PRT+ QA++L A I+ +D A++ VI   ++ +  
Sbjct: 61  DSLTIALVRERLSEPDIKEGFILDGFPRTIPQAEALEA-ITKIDHAVNFVISTDKILERL 119

Query: 120 MFKRI-------------QVRVL---EAIASEKSVRSDDKYDVFLKRIENYRKTILPLSS 163
             +R+             Q +V    +A   +  +R DDK +  LKR+E Y K   PL S
Sbjct: 120 TGRRVCSSCGRNYHVLFAQPKVADCCDACGEKLIIREDDKKEAILKRLEAYDKQTKPLIS 179

Query: 164 YYRDMGCLYIIDGMLDMDEV 183
           +Y     L  ID    +DEV
Sbjct: 180 FYEKKNVLANIDAEPQVDEV 199


>gi|289523348|ref|ZP_06440202.1| adenylate kinase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503040|gb|EFD24204.1| adenylate kinase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 217

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 119/209 (56%), Gaps = 21/209 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPG+GKGTQA +L+ K  +  +STGDMLR  V   T LG++ K  M+SG L+ D 
Sbjct: 1   MIFLGPPGAGKGTQAVKLASKYGIAHISTGDMLRYHVKNGTDLGEKAKAYMDSGRLVPDD 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++ ++V +R+   D   GFILDG+PRTV+QA++L   + + D  +DAV+   V++ ++ +
Sbjct: 61  LIIEMVKERLEEEDAKRGFILDGFPRTVNQAEALEVLLKSKDITLDAVVLFDVDEETLVR 120

Query: 123 RIQVRVL----EAIASEKSV-----------------RSDDKYDVFLKRIENYRKTILPL 161
           R+  R +     AI +  +                  R DD+ +V  +R++ Y +   PL
Sbjct: 121 RLSGRRICPNCNAIYNVHNSDYPEDGRCKRCGNGLIQRDDDRPEVVRRRLKVYEEETAPL 180

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSIDSL 190
             YYR+ G L  +D   + D V  +I SL
Sbjct: 181 LDYYRNKGSLISVDASSESDAVLYAIVSL 209


>gi|253580640|ref|ZP_04857904.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848011|gb|EES75977.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 214

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYQIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+ PD  +G++LDG+PRT+ QA+ L   ++ +   +D  I++ V D+++
Sbjct: 61  DELTCDLVVDRIQQPDAANGYVLDGFPRTIPQAECLTEALNKLGSKVDYAIDVDVPDSNI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    +  +R DD+ +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLKCGATYHVVHAAPKVEGVCDTCGEKLVLRDDDQPETVQKRLNVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG  D++EV   I ++L
Sbjct: 181 PLIDYYTKEGILKSVDGTKDLEEVFADIVAIL 212


>gi|260428497|ref|ZP_05782476.1| adenylate kinase (ATP-AMP transphosphorylase) [Citreicella sp.
           SE45]
 gi|260422989|gb|EEX16240.1| adenylate kinase (ATP-AMP transphosphorylase) [Citreicella sp.
           SE45]
          Length = 192

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 1/191 (0%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQ+  L ++  + QLSTGDMLR      + LG +V   M  G L++
Sbjct: 1   MNIILLGPPGAGKGTQSGILVEERGMVQLSTGDMLREAKASGSELGNKVAEVMARGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ ++    D   G+I DG+PRT+ QA +L   +  M   +D VIELRV+D ++
Sbjct: 61  DEIVIGLIREKFE-ADPSRGYIFDGFPRTLKQADALGDLLEEMGQKLDKVIELRVDDEAL 119

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  +A A+ + VR+DD  +    R+  Y K   PL  YY   G    IDGM  +
Sbjct: 120 VSRIVNRAEQAKAAGQPVRADDNEESLRTRLMAYYKMTSPLVGYYYAKGLYSRIDGMGQI 179

Query: 181 DEVSRSIDSLL 191
           DEV  ++ + L
Sbjct: 180 DEVKTALAARL 190


>gi|225718488|gb|ACO15090.1| Adenylate kinase isoenzyme 2, mitochondrial [Caligus clemensi]
          Length = 243

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 117/219 (53%), Gaps = 24/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ LGPPGSGKGTQ+ +L +  N+  LSTGD+LR EV   T LG Q+K  +++G L+S
Sbjct: 18  VRMVLLGPPGSGKGTQSPKLKEFFNICHLSTGDLLRHEVRNKTPLGHQIKSIIDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISN-MDCAIDAVIELRVEDAS 119
           D +V ++V   +   +C +GF+LDGYPRTV QA+ L   +    + ++DA +E  ++D+ 
Sbjct: 78  DDVVLKLVEKNLDSRECQNGFLLDGYPRTVSQAEQLDKLLEKRKEPSLDAAVEFAIDDSL 137

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           + +RI  R    +AS +S                       R DD  +   KR+  Y   
Sbjct: 138 LVRRISGRWFH-MASGRSYHEEFKPPKVHAVDDVTGEPLIKRKDDNAETLQKRLATYHSE 196

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            +PL  YY+     + ID  LD   V  +I ++   + K
Sbjct: 197 TMPLVDYYQKRQIHWRIDAALDSSTVFSTIKTIFADLNK 235


>gi|229818219|ref|ZP_04448501.1| hypothetical protein BIFANG_03517 [Bifidobacterium angulatum DSM
           20098]
 gi|229784470|gb|EEP20584.1| hypothetical protein BIFANG_03517 [Bifidobacterium angulatum DSM
           20098]
          Length = 188

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 104/187 (55%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++   +P +STGD+ RA +   T LG +V    + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHYGIPAISTGDIFRANIKGKTELGLKVIAYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V DR+   D  +G+ILDGYPR   Q ++L A +  +   +DAV+ L  +   +
Sbjct: 61  DELTNSIVKDRLAQDDTKNGWILDGYPRNAAQVEALDAMLEELGTPLDAVVALDADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R      +E+  R+DD  D   KR+  Y K   PL   Y+  G L  IDG+ ++
Sbjct: 121 MARIAKR------AEEQGRTDDTPDAIAKRLATYAKETAPLLDTYKSRGQLVAIDGVGEI 174

Query: 181 DEVSRSI 187
           D + ++I
Sbjct: 175 DAIQKNI 181


>gi|69247190|ref|ZP_00604252.1| Adenylate kinase, subfamily [Enterococcus faecium DO]
 gi|227550741|ref|ZP_03980790.1| adenylate kinase [Enterococcus faecium TX1330]
 gi|257878746|ref|ZP_05658399.1| adenylate kinase [Enterococcus faecium 1,230,933]
 gi|257881387|ref|ZP_05661040.1| adenylate kinase [Enterococcus faecium 1,231,502]
 gi|257885655|ref|ZP_05665308.1| adenylate kinase [Enterococcus faecium 1,231,501]
 gi|257888000|ref|ZP_05667653.1| adenylate kinase [Enterococcus faecium 1,141,733]
 gi|257890605|ref|ZP_05670258.1| adenylate kinase [Enterococcus faecium 1,231,410]
 gi|257893195|ref|ZP_05672848.1| adenylate kinase [Enterococcus faecium 1,231,408]
 gi|257896381|ref|ZP_05676034.1| adenylate kinase [Enterococcus faecium Com12]
 gi|257899355|ref|ZP_05679008.1| adenylate kinase [Enterococcus faecium Com15]
 gi|258615190|ref|ZP_05712960.1| adenylate kinase [Enterococcus faecium DO]
 gi|260558308|ref|ZP_05830504.1| adenylate kinase [Enterococcus faecium C68]
 gi|261207014|ref|ZP_05921703.1| adenylate kinase [Enterococcus faecium TC 6]
 gi|289565351|ref|ZP_06445801.1| adenylate kinase [Enterococcus faecium D344SRF]
 gi|293379467|ref|ZP_06625611.1| adenylate kinase [Enterococcus faecium PC4.1]
 gi|293553900|ref|ZP_06674506.1| adenylate kinase [Enterococcus faecium E1039]
 gi|293562967|ref|ZP_06677434.1| adenylate kinase [Enterococcus faecium E1162]
 gi|293567910|ref|ZP_06679251.1| adenylate kinase [Enterococcus faecium E1071]
 gi|293570705|ref|ZP_06681755.1| adenylate kinase [Enterococcus faecium E980]
 gi|294615372|ref|ZP_06695245.1| adenylate kinase [Enterococcus faecium E1636]
 gi|294621100|ref|ZP_06700291.1| adenylate kinase [Enterococcus faecium U0317]
 gi|314937629|ref|ZP_07844955.1| adenylate kinase [Enterococcus faecium TX0133a04]
 gi|314942872|ref|ZP_07849685.1| adenylate kinase [Enterococcus faecium TX0133C]
 gi|314947992|ref|ZP_07851396.1| adenylate kinase [Enterococcus faecium TX0082]
 gi|314950909|ref|ZP_07853978.1| adenylate kinase [Enterococcus faecium TX0133A]
 gi|314991443|ref|ZP_07856920.1| adenylate kinase [Enterococcus faecium TX0133B]
 gi|314995036|ref|ZP_07860156.1| adenylate kinase [Enterococcus faecium TX0133a01]
 gi|68194955|gb|EAN09423.1| Adenylate kinase, subfamily [Enterococcus faecium DO]
 gi|227180202|gb|EEI61174.1| adenylate kinase [Enterococcus faecium TX1330]
 gi|257812974|gb|EEV41732.1| adenylate kinase [Enterococcus faecium 1,230,933]
 gi|257817045|gb|EEV44373.1| adenylate kinase [Enterococcus faecium 1,231,502]
 gi|257821511|gb|EEV48641.1| adenylate kinase [Enterococcus faecium 1,231,501]
 gi|257824054|gb|EEV50986.1| adenylate kinase [Enterococcus faecium 1,141,733]
 gi|257826965|gb|EEV53591.1| adenylate kinase [Enterococcus faecium 1,231,410]
 gi|257829574|gb|EEV56181.1| adenylate kinase [Enterococcus faecium 1,231,408]
 gi|257832946|gb|EEV59367.1| adenylate kinase [Enterococcus faecium Com12]
 gi|257837267|gb|EEV62341.1| adenylate kinase [Enterococcus faecium Com15]
 gi|260075482|gb|EEW63788.1| adenylate kinase [Enterococcus faecium C68]
 gi|260078642|gb|EEW66344.1| adenylate kinase [Enterococcus faecium TC 6]
 gi|289162841|gb|EFD10691.1| adenylate kinase [Enterococcus faecium D344SRF]
 gi|291589495|gb|EFF21302.1| adenylate kinase [Enterococcus faecium E1071]
 gi|291591746|gb|EFF23382.1| adenylate kinase [Enterococcus faecium E1636]
 gi|291599336|gb|EFF30362.1| adenylate kinase [Enterococcus faecium U0317]
 gi|291601952|gb|EFF32198.1| adenylate kinase [Enterococcus faecium E1039]
 gi|291605093|gb|EFF34560.1| adenylate kinase [Enterococcus faecium E1162]
 gi|291609177|gb|EFF38449.1| adenylate kinase [Enterococcus faecium E980]
 gi|292641990|gb|EFF60156.1| adenylate kinase [Enterococcus faecium PC4.1]
 gi|313590762|gb|EFR69607.1| adenylate kinase [Enterococcus faecium TX0133a01]
 gi|313593923|gb|EFR72768.1| adenylate kinase [Enterococcus faecium TX0133B]
 gi|313596918|gb|EFR75763.1| adenylate kinase [Enterococcus faecium TX0133A]
 gi|313598344|gb|EFR77189.1| adenylate kinase [Enterococcus faecium TX0133C]
 gi|313643006|gb|EFS07586.1| adenylate kinase [Enterococcus faecium TX0133a04]
 gi|313645590|gb|EFS10170.1| adenylate kinase [Enterococcus faecium TX0082]
          Length = 215

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 118/218 (54%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNLILMGLPGAGKGTQAEKIIDAYGIPHISTGDMFRAAMQNETALGLEAKSYMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD + GF+LDG+PRT+DQAK+L A + +++  IDAVI++ V +  +
Sbjct: 61  DEVTNGIVKERLAEPDTEKGFLLDGFPRTLDQAKALDAMLKDLNKKIDAVIDIHVGEEIL 120

Query: 121 FKRIQVRVL--------EAIASEKSV--------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R +          I +   V              R DDK +    R+    K  
Sbjct: 121 VERLAGRFICSNCGATYHKIFNPTKVEDTCDRCGGHEFYQREDDKPETVKNRLAINIKNS 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ +YY++ G L  IDG       +R ID++   V+K
Sbjct: 181 EPILAYYKEQGLLNTIDG-------AREIDAVFADVQK 211


>gi|318346227|ref|NP_001187835.1| mitochondrial adenylate kinase 2 [Ictalurus punctatus]
 gi|308324100|gb|ADO29185.1| mitochondrial adenylate kinase 2 [Ictalurus punctatus]
          Length = 235

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   T LGK++K +M++G L+ 
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAEKFCVCHLATGDMLRAMVASGTELGKRLKATMDAGKLVG 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C  GF+LDG+PRTV QA+ L   +      +D+VIE  VED+ +
Sbjct: 78  DEMVVELIEKNLDTPACKEGFLLDGFPRTVKQAEMLDDLLEKRTEKLDSVIEFSVEDSLL 137

Query: 121 FKRIQVRVLEAIASEK---------------------SVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R++   +                        + RSDD       R+E Y K   
Sbjct: 138 VRRICGRLIHQSSGRSYHEEFNPPKEPMKDDVTGEPLTRRSDDNEKTLRSRLEAYHKQTA 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G  + ID     + V  SI
Sbjct: 198 PLVQYYSARGIHHAIDAAQSPEVVFASI 225


>gi|320593795|gb|EFX06198.1| adenylate kinase [Grosmannia clavigera kw1407]
          Length = 274

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 117/223 (52%), Gaps = 22/223 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K     L+TGDMLR++V + T LG++ K  M+ G L+S
Sbjct: 40  IRMILIGPPGAGKGTQAPKIKEKFGCCHLATGDMLRSQVAKKTPLGREAKKIMDQGGLVS 99

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ + +   P+C  GFILDG+PRTV QA+ L + +   +  +   +EL+++D+ 
Sbjct: 100 DDIVIGMIKEELNTNPECKGGFILDGFPRTVPQAEGLDSMLKERNQTLQHAVELQIDDSL 159

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  D   KR+  Y    
Sbjct: 160 LVARITGRLVHPASGRSYHKLFNPPKKEMTDDITGEPLVQRSDDNADALKKRLSTYHVQT 219

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
            P+  YYR  G    ID      +V  ++  +     KK SSS
Sbjct: 220 APVVDYYRKTGIWSAIDASQKPGQVWSTLLKIFDGDAKKASSS 262


>gi|289706553|ref|ZP_06502903.1| adenylate kinase [Micrococcus luteus SK58]
 gi|289556688|gb|EFD50029.1| adenylate kinase [Micrococcus luteus SK58]
          Length = 205

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 113/199 (56%), Gaps = 6/199 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPGSGKGTQA R++ KL +  +STGD+ R  V   T LG + K  +++G  + D
Sbjct: 3   RMLLMGPPGSGKGTQATRIADKLGIVPISTGDIFRHNVKSMTPLGVEAKKYIDNGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V DRI   D + GF+LDGYPRT  Q ++L A ++    ++ AV+EL V D  + 
Sbjct: 63  EVTNRMVADRIAQADAEHGFLLDGYPRTKGQVEALDAMLAEAGLSLSAVVELEVPDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R      +E   R+DD  +V   R++ Y +    +   Y + G +  +DG   +D
Sbjct: 123 ERLLKR------AEIEGRADDTQEVIEHRLDLYHRETESVIQEYVERGIVARVDGTGQID 176

Query: 182 EVSRSIDSLLVSVRKKCSS 200
           +V+  +   + SVR    S
Sbjct: 177 DVTERLLQAVYSVRSATGS 195


>gi|16329922|ref|NP_440650.1| adenylate kinase [Synechocystis sp. PCC 6803]
 gi|1652408|dbj|BAA17330.1| adenylate kinase [Synechocystis sp. PCC 6803]
          Length = 187

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 108/189 (57%), Gaps = 10/189 (5%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLG PGSGKGTQA  L++ L +P +STGDMLR  +   T LG Q KG M+ G L+ D 
Sbjct: 7   LIFLGAPGSGKGTQAVGLAETLGIPHISTGDMLRQAIADGTELGNQAKGYMDKGELVPDQ 66

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++  ++ +R+   D  +G+ILDG+PR V+QA  L   + N+      VI L+V D  + +
Sbjct: 67  LILGLIEERLGHKDAKAGWILDGFPRNVNQAIFLDELLVNIGHRTHWVINLKVPDEVIVE 126

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R           R+DD       R+  Y +   PL +YY++ G LY +DG   ++ 
Sbjct: 127 RLLAR----------GRADDNETTIRNRLLVYTEQTAPLMAYYQEQGKLYSLDGNQPVEA 176

Query: 183 VSRSIDSLL 191
           ++ +++ L+
Sbjct: 177 IATNLEKLV 185


>gi|148226520|ref|NP_001080232.1| adenylate kinase 2, mitochondrial [Xenopus laevis]
 gi|82177160|sp|Q8AVD3|KAD2_XENLA RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|27370911|gb|AAH41509.1| Ak2 protein [Xenopus laevis]
          Length = 241

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGKRLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C  GF+LDG+PRTV QA+ L   +      +D+VIE +V+D+ +
Sbjct: 78  DEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++ A                    +  E  + RSDD       R+E Y     
Sbjct: 138 VRRICGRLIHASSGRSYHEEFNPPKEPMKDDVTGEALIRRSDDNESTLKSRLEAYHTMTS 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY+  G    +D     D V  SI
Sbjct: 198 PLVDYYQRHGIHTAVDAAQSPDVVFASI 225


>gi|150015064|ref|YP_001307318.1| adenylate kinase [Clostridium beijerinckii NCIMB 8052]
 gi|189046009|sp|A6LPT2|KAD_CLOB8 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|149901529|gb|ABR32362.1| Nucleoside-triphosphate--adenylate kinase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 216

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+ LGPPG+GKGTQA  +S K ++P +STGD+ R  +  NT LG + KG +++G L+ 
Sbjct: 1   MKIVLLGPPGAGKGTQAKSISNKYSIPHISTGDIFRKNISENTPLGIEAKGYIDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR++  DC  G++LDG+PRTV QA +L+ F+ + +  +D  + ++V +  +
Sbjct: 61  DEVTINMVKDRLQQDDCKVGYLLDGFPRTVAQADALNNFLVDKNEQLDTALLIKVPNEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   SE   R DD  +   +R++ Y+K   
Sbjct: 121 LERMTGRRVCPSCGASYHVKFNPPTNEGKCDLCGSEVIQRKDDTVETVKERLDVYQKETQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y + G L  +DG   ++EV R I  LL
Sbjct: 181 PLIEFYGEKGLLSEVDGTKAINEVFRGICELL 212


>gi|294101649|ref|YP_003553507.1| adenylate kinase [Aminobacterium colombiense DSM 12261]
 gi|293616629|gb|ADE56783.1| adenylate kinase [Aminobacterium colombiense DSM 12261]
          Length = 218

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +  K  V  +STGD+LR  V   T LG Q +  M  G L+ 
Sbjct: 1   MRVILLGPPGAGKGTQAAEIKTKYKVAHISTGDILRQNVKEKTKLGCQAQEFMNGGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R++  DC+ GF+LDG+PRTV QA++L   ++ M+ ++DAVI L V+D  +
Sbjct: 61  DEIIVGMMGERLKEKDCEKGFLLDGFPRTVPQAEALDQLLATMNLSLDAVILLDVDDEVV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     E    E   R DDK  V   R++ Y     
Sbjct: 121 VKRLCGRRMCRQCGEIYHVTFKPSSQGMRCEKCGGELFQRDDDKETVIRSRLKVYHDQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL SYY + G L  ++       V   I++L+
Sbjct: 181 PLISYYDEKGLLRKVNAGTSSSSVMAEIEALV 212


>gi|73949911|ref|XP_535321.2| PREDICTED: similar to Adenylate kinase isoenzyme 2, mitochondrial
           (ATP-AMP transphosphorylase) isoform 1 [Canis
           familiaris]
          Length = 241

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 78  DEMVVELIEKNLETPQCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  V RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLVRRSDDNEKALKIRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G   +ID     D V  SI
Sbjct: 198 PLVDYYRKRGIHSVIDATQTPDVVFASI 225


>gi|229829408|ref|ZP_04455477.1| hypothetical protein GCWU000342_01498 [Shuttleworthia satelles DSM
           14600]
 gi|229791839|gb|EEP27953.1| hypothetical protein GCWU000342_01498 [Shuttleworthia satelles DSM
           14600]
          Length = 232

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++    +P +STGD+ RA +   T LGK+ K  M++G+L+ 
Sbjct: 7   MKIIMLGAPGAGKGTQAKQIASAYGIPHISTGDIFRANIKNQTPLGKKAKEYMDAGNLVP 66

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI   DC+ GF+LDG+PRT+ QA++L   ++    +ID  I + V D ++
Sbjct: 67  DELTCDLLMDRIGQDDCEDGFVLDGFPRTIPQARALGKALTARGESIDFAINVEVPDENI 126

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +A  SE   R+DD       R++ Y +   
Sbjct: 127 IRRMSGRRVCPSCGATYHLVALPPEKEGVCDACGSELIQRADDSEATVANRLQVYHEQTQ 186

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG   MD V   I ++L
Sbjct: 187 PLIDYYEREGVLKTVDGTQPMDVVFAQIKAIL 218


>gi|271499629|ref|YP_003332654.1| adenylate kinase [Dickeya dadantii Ech586]
 gi|270343184|gb|ACZ75949.1| adenylate kinase [Dickeya dadantii Ech586]
          Length = 214

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++         A+D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KEAGIAVDHVIEFDVPDELI 116

Query: 121 FKRIQVRVLEAIAS---------------------EKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A +                      E ++R DD+ D   KR+  Y +   
Sbjct: 117 VERIIGRRVHAASGRVYHVKFNPPKVEGKDDVTGDELTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+          + IDG   +++VS  +  +L
Sbjct: 177 PLVNYYQQEAAANHTLYHKIDGTRPVNDVSAELARIL 213


>gi|330470152|ref|YP_004407895.1| adenylate kinase [Verrucosispora maris AB-18-032]
 gi|328813123|gb|AEB47295.1| adenylate kinase [Verrucosispora maris AB-18-032]
          Length = 217

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 117/212 (55%), Gaps = 22/212 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++  L+VP++STGD+ RA V + T LG + K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEFIAAHLSVPKISTGDIFRANVSQGTPLGVEAKRYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+  PD   GF+LDG+PRT  QA +L   ++++  A+D V+EL V+D  +
Sbjct: 61  DEVTINMVRDRLAEPDTAEGFLLDGFPRTTPQAAALDKLLADLGTALDIVLELVVDDDEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +   +E   R DDK +    R+  Y     
Sbjct: 121 IRRLSGRRTCRGCGKIWHVEFDATSREGICDRCGAELFQRDDDKPETIAARLREYADKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
           PL  YY   G L  ID    +++V+ R+ID+L
Sbjct: 181 PLVDYYGAQGKLVGIDATGPVEDVTVRAIDAL 212


>gi|6647539|sp|P73302|KAD1_SYNY3 RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1
          Length = 185

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 108/189 (57%), Gaps = 10/189 (5%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLG PGSGKGTQA  L++ L +P +STGDMLR  +   T LG Q KG M+ G L+ D 
Sbjct: 5   LIFLGAPGSGKGTQAVGLAETLGIPHISTGDMLRQAIADGTELGNQAKGYMDKGELVPDQ 64

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           ++  ++ +R+   D  +G+ILDG+PR V+QA  L   + N+      VI L+V D  + +
Sbjct: 65  LILGLIEERLGHKDAKAGWILDGFPRNVNQAIFLDELLVNIGHRTHWVINLKVPDEVIVE 124

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R           R+DD       R+  Y +   PL +YY++ G LY +DG   ++ 
Sbjct: 125 RLLAR----------GRADDNETTIRNRLLVYTEQTAPLMAYYQEQGKLYSLDGNQPVEA 174

Query: 183 VSRSIDSLL 191
           ++ +++ L+
Sbjct: 175 IATNLEKLV 183


>gi|240145857|ref|ZP_04744458.1| adenylate kinase [Roseburia intestinalis L1-82]
 gi|257202005|gb|EEV00290.1| adenylate kinase [Roseburia intestinalis L1-82]
          Length = 214

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 116/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K ++P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIADKYHIPHISTGDIFRANIKNGTELGNKAKQYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  DC++GF+LDG+PRT+ QA++L A +  ++  +D  I++ V DA++
Sbjct: 61  DELTCDLVMDRIKQDDCENGFVLDGFPRTIPQAEALTAALEKINEKMDYAIDVDVPDANI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +       +R DDK +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLNCGATYHIVSIPTKVEGICDRCGQPVVLRDDDKPETVQKRLTVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+    L  +DG   M++V   I ++L
Sbjct: 181 PLIDYYKKQSILKTVDGTQPMEKVFADIVAIL 212


>gi|329577728|gb|EGG59154.1| adenylate kinase [Enterococcus faecalis TX1467]
          Length = 231

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 117/218 (53%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  ++ G L+ 
Sbjct: 16  MNLILMGLPGAGKGTQAEKIIDTYGIPHISTGDMFRAAMKNETALGLEAKSYIDKGELVP 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD D GF+LDG+PRT+DQAK+L+  +  ++  IDAVI++ VE+  +
Sbjct: 76  DEVTNGIVKERLAEPDTDKGFLLDGFPRTLDQAKALYTMLKELNKKIDAVIDIHVEEDVL 135

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            +R+  R +                           E   R DDK +    R+    ++ 
Sbjct: 136 IERLAGRFICRTCGATYHKLFNPPKVEGTCDRCGGHEFYQREDDKPETVKNRLAVNIESS 195

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ ++Y++ G ++ IDG       +R ID++   V+K
Sbjct: 196 APILAFYKEQGLMHTIDG-------NREIDTVFSDVKK 226


>gi|301772968|ref|XP_002921900.1| PREDICTED: adenylate kinase 2, mitochondrial-like [Ailuropoda
           melanoleuca]
          Length = 234

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 78  DEMVVELIEKNLETPRCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  V RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLVRRSDDNEKALKIRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G   +ID     D V  SI
Sbjct: 198 PLVEYYRKRGIHSVIDATQTPDVVFASI 225


>gi|77020256|ref|NP_001029139.1| adenylate kinase 2, mitochondrial isoform b [Rattus norvegicus]
 gi|38511598|gb|AAH61727.1| Adenylate kinase 2 [Rattus norvegicus]
 gi|149024021|gb|EDL80518.1| rCG31186, isoform CRA_a [Rattus norvegicus]
          Length = 232

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDVVFASI 223


>gi|167465209|ref|ZP_02330298.1| Adenylate kinase [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 217

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 108/212 (50%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M IIF+GPPG+GKGTQA ++     +P +STGD  R  + + T LG + KG ++ G L+ 
Sbjct: 1   MNIIFMGPPGAGKGTQAEKIVSDFQIPHISTGDAFRLAMSQGTPLGIKAKGYVDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V +R+  PDC  GF+LDGYPRT+ QA +L   + +    ID V+ L V+   +
Sbjct: 61  DEITNGIVKERLEQPDCAKGFLLDGYPRTIAQADALDEMLKSQSRQIDHVMNLTVDRELL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E   RSDD  +    R++ Y     
Sbjct: 121 LARLTGRRICKSCGATYHVLFNPPKHEGICDKCGGELYQRSDDTEEKVGTRLDEYTNKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR  G L  ++G  D+  V+  I S+L
Sbjct: 181 PLLDYYRQKGILREVNGEQDITAVTSEISSIL 212


>gi|326566062|gb|EGE16222.1| adenylate kinase [Moraxella catarrhalis 12P80B1]
          Length = 219

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 32/221 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++  +PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQLISKEFGIPQISTGDMLRAAIKAGTELGKQAKSVMDAGQLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PDCD+G I DG+PRT+ QAK+L    ++   AID VIE+   D  +
Sbjct: 62  DELIINLVKERLKQPDCDNGCIFDGFPRTIPQAKAL----ADAGIAIDYVIEISAPDDEI 117

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     ++ +  E  V R DDK +V   R+  Y     
Sbjct: 118 VSRMSGRRAHLASGRTYHVIYNPPKTDGIDDVTGEALVQRDDDKEEVVRDRLSVYHAQTT 177

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLLVS 193
            L S+Y+++          +  DG   +D V   I ++L S
Sbjct: 178 TLISHYQEVAKSGENAPEYHDFDGTKSIDTVRDEIFAVLKS 218


>gi|331005354|ref|ZP_08328738.1| Adenylate kinase [gamma proteobacterium IMCC1989]
 gi|330420808|gb|EGG95090.1| Adenylate kinase [gamma proteobacterium IMCC1989]
          Length = 218

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 123/220 (55%), Gaps = 33/220 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  ++++  +PQ+STGDMLRA V+  T LG QVK  M SG L+S
Sbjct: 1   MRIILLGAPGAGKGTQAKLMTEEFGIPQISTGDMLRAAVNAGTELGLQVKDVMSSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI+  DC+ GF+LDG+PRT+ QA ++     +    ID V+E+ VED  +
Sbjct: 61  DDIIIALVKERIQQADCEKGFLLDGFPRTIPQADAM----KDAGVIIDNVVEIYVEDEEI 116

Query: 121 FKRIQVRVL-----------------EAIASEKS----VRSDDKYDVFLKRIENYRKTIL 159
             R+  R +                 E +  E       R DD+     KR++ Y +   
Sbjct: 117 VSRLSGRRVHKESGRIYHLVYNPPKTEGVDDETGEALIQREDDQEATIRKRLDVYHQQTE 176

Query: 160 PLSSYYRDMG-------CLYI-IDGMLDMDEVSRSIDSLL 191
           PL  +Y+++G         Y+ I+G+ +++++ R + S L
Sbjct: 177 PLVEFYKNLGEQQGSPAPKYVRIEGVGEVEDIKRQLFSAL 216


>gi|145238876|ref|XP_001392085.1| adenylate kinase 1 [Aspergillus niger CBS 513.88]
 gi|224493046|sp|A2QPN9|KAD1_ASPNC RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|134076586|emb|CAK45139.1| unnamed protein product [Aspergillus niger]
          Length = 258

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA RL +K  V  L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 43  MRIILMGPPGAGKGTQAPRLKEKYCVCHLATGDMLRSQVAKKTALGKEAKKIMDQGGLVS 102

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   ++     +   +EL+++DA 
Sbjct: 103 DEIMVNMIQSELDNNAECKNGFILDGFPRTVAQAERLDDMLNARQQKLQHAVELQIDDAL 162

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR+  Y   
Sbjct: 163 LVARITGRLVHP-ASGRSYHKIFNPPKEEMKDDVTGEPLIQRSDDNADTLKKRLGTYHAQ 221

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 222 TAPVVEYYKKTGIWRGIDASQEPGQVWKSL 251


>gi|13591872|ref|NP_112248.1| adenylate kinase 2, mitochondrial isoform a [Rattus norvegicus]
 gi|266401|sp|P29410|KAD2_RAT RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|220796|dbj|BAA02378.1| adenylate kinase 2 [Rattus norvegicus]
          Length = 239

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDVVFASI 223


>gi|149024022|gb|EDL80519.1| rCG31186, isoform CRA_b [Rattus norvegicus]
          Length = 239

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDVVFASI 223


>gi|74207572|dbj|BAE40035.1| unnamed protein product [Mus musculus]
          Length = 232

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKHGIHCAIDASQTPDIVFASI 223


>gi|163815998|ref|ZP_02207368.1| hypothetical protein COPEUT_02178 [Coprococcus eutactus ATCC 27759]
 gi|158448808|gb|EDP25803.1| hypothetical protein COPEUT_02178 [Coprococcus eutactus ATCC 27759]
          Length = 214

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  ++ K  VP +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKMIAAKYGVPHISTGDIFRANIKNGTELGAKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR +  DC  G+ILDG+PRT+ QA++L   +S +  ++D  I + V D ++
Sbjct: 61  DELVVDLVIDRFKADDCAKGYILDGFPRTIPQAEALDKALSAIGDSVDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +   ++  +R DDK +   KR++ Y +   
Sbjct: 121 IERMSGRRACVGCGATYHIVYNPTKVEGKCDTCGADLILRDDDKPETVKKRLDVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  +DG +DM +V  +I  +L
Sbjct: 181 PLIDYYKAKGILKEVDGTVDMKDVFAAITDIL 212


>gi|313673447|ref|YP_004051558.1| adenylate kinase [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940203|gb|ADR19395.1| Adenylate kinase [Calditerrivibrio nitroreducens DSM 19672]
          Length = 215

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 120/213 (56%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++FLGPPG+GKGTQ+  +  +  V Q+STGD+LR+ V   T LGK  K  M+ G L+ 
Sbjct: 2   VNLVFLGPPGAGKGTQSSYIINEYKVVQISTGDILRSAVKEGTELGKMAKKYMDEGKLVP 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFIS-NMDCAIDAVIELRVEDAS 119
           D ++  +V +R++  DC +GFILDG+PRT+ QA SL A +  +++ ++  +I L V+D  
Sbjct: 62  DDVIIGIVRERLKQDDCKNGFILDGFPRTIPQAVSLDAMLKDDLNISLTHIISLEVDDNL 121

Query: 120 MFKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
           + +R+  R                     V +    E   R DDK +   KR++ Y +  
Sbjct: 122 IMERLTGRRTCKGCGKVYHIKYNPPKKEGVCDDCGGELYQRDDDKEETIAKRLKVYHEQT 181

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             L  YY++ G LY++DG+ ++ ++ R I  +L
Sbjct: 182 SALKDYYKNSGKLYVVDGVGEVGDIYRKIKEIL 214


>gi|294618299|ref|ZP_06697880.1| adenylate kinase [Enterococcus faecium E1679]
 gi|291595393|gb|EFF26705.1| adenylate kinase [Enterococcus faecium E1679]
          Length = 215

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 118/218 (54%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNLILMGLPGAGKGTQAEKIIDAYGIPHISTGDMFRAAMQNETALGLEAKSYMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD + GF+LDG+PRT+DQAK+L A + +++  IDAVI++ V +  +
Sbjct: 61  DEVTNGIVKERLAEPDTERGFLLDGFPRTLDQAKALDAMLKDLNKKIDAVIDIHVGEEIL 120

Query: 121 FKRIQVRVL--------EAIASEKSV--------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R +          I +   V              R DDK +    R+    K  
Sbjct: 121 VERLAGRFICSNCGATYHKIFNPTKVEDTCDRCGGHEFYQREDDKPETVKNRLAINIKNS 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ +YY++ G L  IDG       +R ID++   V+K
Sbjct: 181 EPILAYYKEQGLLNTIDG-------AREIDAVFADVQK 211


>gi|156538681|ref|XP_001607764.1| PREDICTED: similar to SD09634p [Nasonia vitripennis]
          Length = 249

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA  L ++  V  LSTGDMLRAE+   + LG ++K  M++G L+SD +
Sbjct: 23  VLLGPPGSGKGTQAPMLKERYCVCHLSTGDMLRAEIQSGSALGAELKKVMDAGKLVSDDL 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C  GF+LDG+PRTV QA+ L   +      +DAVIE  ++D  + KR
Sbjct: 83  VVNMIDKNLEKPECQRGFLLDGFPRTVPQAEKLDEMLEKKKTKLDAVIEFGIDDNLLVKR 142

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+ +Y     PL 
Sbjct: 143 ITGRLIHPASGRSYHEEFAPPKVAMKDDITGEPLIKRSDDNAEALKKRLASYHSQTQPLV 202

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
            YY   G    ++     ++V + ID++ ++ 
Sbjct: 203 DYYALRGIHNYVNAAKSSEQVFKDIDTIFLTA 234


>gi|294010634|ref|YP_003544094.1| adenylate kinase [Sphingobium japonicum UT26S]
 gi|292673964|dbj|BAI95482.1| adenylate kinase [Sphingobium japonicum UT26S]
          Length = 221

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 112/213 (52%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +G + K  ME+G L+S
Sbjct: 4   MNIILLGPPGAGKGTQATRLVDSRAMVQLSTGDMLRAAVKAGTPIGLKAKAVMEAGELVS 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ + +     ++G I DGYPRT  QA SL   +++ +  +D VIEL V++ ++
Sbjct: 64  DEIVSGIIGEALDALAPETGVIFDGYPRTEAQAHSLDGILADRNRTLDHVIELEVDEDAL 123

Query: 121 FKRIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTI 158
            +RI  R   A   E                         R DD  +    R+  YR   
Sbjct: 124 VERITGRFTCATCGEGYHDRFKTPKVEGACDKCGGHEFKRRPDDNEETVRTRMAEYRAKT 183

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+   Y   G +  +DGM DMD+V+ +I ++L
Sbjct: 184 APILPIYEARGIVSRVDGMADMDDVTVAIAAIL 216


>gi|238061100|ref|ZP_04605809.1| adenylate kinase [Micromonospora sp. ATCC 39149]
 gi|237882911|gb|EEP71739.1| adenylate kinase [Micromonospora sp. ATCC 39149]
          Length = 217

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 118/212 (55%), Gaps = 22/212 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++  L+VP++STGD+ RA V + T LG + K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEFIAAHLSVPKISTGDIFRANVSQGTPLGVEAKRYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+  PD   GF+LDG+PRT  QA +L   ++++  A+D V+EL V+D  +
Sbjct: 61  DEVTINMVRDRLAEPDASEGFLLDGFPRTTPQAAALDKLLADLGTALDLVLELVVDDDEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +   ++   R DDK +    R+  Y +   
Sbjct: 121 IRRLSGRRTCRGCGKIWHVEFDATTRDGICDRCGADLFQRDDDKPETIAARLREYAEKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
           PL  YY   G L  ID    +++V+ R+ID+L
Sbjct: 181 PLVDYYGAQGKLVGIDATGPVEDVTVRAIDAL 212


>gi|94968275|ref|YP_590323.1| adenylate kinase [Candidatus Koribacter versatilis Ellin345]
 gi|94550325|gb|ABF40249.1| Adenylate kinase [Candidatus Koribacter versatilis Ellin345]
          Length = 236

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 120/223 (53%), Gaps = 37/223 (16%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I  GPPG+GKGTQ+ RL Q L VPQ+STGD+LR  V + T  GKQ K +MESG L+SD 
Sbjct: 11  VILFGPPGAGKGTQSKRLVQALGVPQISTGDILRENVAQETGWGKQAKAAMESGQLVSDF 70

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFI-------------SNMDCAIDA 109
           IV  +V +R+  PD   G ILDG+PRTV QA+ L   +             SN+      
Sbjct: 71  IVCAMVAERLGKPDTSRGCILDGFPRTVAQAEWLDKLLTGKLFESTRVSLASNLP---PV 127

Query: 110 VIELRVEDASMFKRIQVR-----------------VLEAI----ASEKSVRSDDKYDVFL 148
           VI ++V+   + +R+  R                  +E I     S+  +R DD+ +V  
Sbjct: 128 VISIKVDYNQLLQRLTGRRSCPSCGTIYNVYSKPPKVEGICDLEGSKLVMRQDDREEVIA 187

Query: 149 KRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            R++ Y +  LPL  YYR  G L+ I+G   +++++  + SL+
Sbjct: 188 GRLKAYEQQTLPLEKYYRAQGRLFEINGDAPVEKITEEMLSLI 230


>gi|182436606|ref|YP_001824325.1| adenylate kinase [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|226743907|sp|B1W3Y6|KAD_STRGG RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|178465122|dbj|BAG19642.1| putative adenylate kinase [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 219

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 115/216 (53%), Gaps = 23/216 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L+Q L++P ++TGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAQNLSIPHIATGDLFRANISQGTDLGKQARAYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+   D   GF+LDG+PR V QA++L   + +    +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMAQADAAGGFLLDGFPRNVGQAEALDVMLKDEGVKLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +A   E   R DD  +    R+E Y    
Sbjct: 121 VKRIAGRRVCRNNSAHVFHLTYNPPKAEGVCDACGGELYQRDDDSEETVRTRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSLLVS 193
            P+  YYR  G +  I  +  + +V+ R++++L  S
Sbjct: 181 EPIIDYYRAQGLVVTISALGKVADVTARAMEALKAS 216


>gi|281351774|gb|EFB27358.1| hypothetical protein PANDA_010835 [Ailuropoda melanoleuca]
          Length = 241

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 78  DEMVVELIEKNLETPRCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  V RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLVRRSDDNEKALKIRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G   +ID     D V  SI
Sbjct: 198 PLVEYYRKRGIHSVIDATQTPDVVFASI 225


>gi|227328735|ref|ZP_03832759.1| adenylate kinase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 214

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAM----KDAGINVDYVIEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        + ++R DD+ D   KR+  Y +   
Sbjct: 117 IDRIIGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+   D G    + ++G   ++EV   ++++L
Sbjct: 177 PLVSYYQKEADAGNTRYFKVEGTRKVEEVRAELETIL 213


>gi|160947679|ref|ZP_02094846.1| hypothetical protein PEPMIC_01614 [Parvimonas micra ATCC 33270]
 gi|158446813|gb|EDP23808.1| hypothetical protein PEPMIC_01614 [Parvimonas micra ATCC 33270]
          Length = 216

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +  +  +  +STGD+ R  +   T LGK+VK  ++ G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQASSIVAEYGITHISTGDIFRHNIKNETELGKKVKSYLDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC +GF+LDG+PRT++QA++L   +      +D VI + V+   +
Sbjct: 61  DELTIDLVWDRLSKEDCKNGFLLDGFPRTINQAEALQKGLEERGLKLDKVINIDVDKNIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +  + E   R+DD     L RIE Y     
Sbjct: 121 VKRLSGRRVCKNCGETYHIDNKPTSKDGVCDKCSGEVIQRADDNEKTVLDRIEVYENQTF 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y+++G +  +DG L +++V   I
Sbjct: 181 PLIDFYKNLGLVLTVDGTLSIEDVFSQI 208


>gi|313682125|ref|YP_004059863.1| adenylate kinase [Sulfuricurvum kujiense DSM 16994]
 gi|313154985|gb|ADR33663.1| Adenylate kinase [Sulfuricurvum kujiense DSM 16994]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 120/219 (54%), Gaps = 33/219 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  L++  ++PQ+STGDMLRA +   T LG   K  M++G L++
Sbjct: 1   MKIILLGAPGAGKGTQAQFLTKAFDIPQISTGDMLRAAIKAGTELGTLAKSFMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI   DC +GF+LDG+PRTV QA +L         AIDAVIE+ V D+ +
Sbjct: 61  DEIIIGLVKERITQDDCKNGFLLDGFPRTVPQADAL----KEAGVAIDAVIEIDVADSVI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R    +AS ++                       R DDK +V L R+  Y +  
Sbjct: 117 VERMSGRRAH-LASGRTYHIVYNPPKVEGKDDETGEDLVQRDDDKAEVVLDRLRVYHEQT 175

Query: 159 LPLSSYYR-----DMGCLYI-IDGMLDMDEVSRSIDSLL 191
            PL +YY+     D    YI IDG   +D V + I S L
Sbjct: 176 SPLVNYYKGVAASDETVKYITIDGTQKIDAVEKEILSKL 214


>gi|146297265|ref|YP_001181036.1| nucleoside-triphosphate--adenylate kinase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166219980|sp|A4XLR0|KAD_CALS8 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|145410841|gb|ABP67845.1| Adenylate kinase [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 112/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  LS +  +P +STGD+LR  V   T LGK+ K  M+ G L+ 
Sbjct: 1   MRLIILGAPGAGKGTQAEYLSSRFGIPHISTGDILRENVKNQTELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV ++V +R+   DC +GF+LDG+PRT+ QA++L   ++++   ID V+ + V D  +
Sbjct: 61  DEIVIEIVKNRLMQDDCKNGFLLDGFPRTIAQAEALEKVLADLGQKIDKVLNIEVPDEKI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    +   R DDK +   KR+E Y     
Sbjct: 121 LERMSGRRICKSCGASFHVVYRPPKKEGICDICGGQLYQREDDKEETVKKRLEVYHAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY++ G L    G  ++ + ++ +
Sbjct: 181 PLIEYYKNKGLLVTAVGQEEIADTTKEV 208


>gi|315283820|ref|ZP_07871887.1| adenylate kinase [Listeria marthii FSL S4-120]
 gi|313612535|gb|EFR86610.1| adenylate kinase [Listeria marthii FSL S4-120]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 116/214 (54%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LG++ K  M++G L+ 
Sbjct: 1   MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGRKAKSFMDNGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D   GF+LDG+PRTV+QA+ L   + ++   +DAVI + VE   +
Sbjct: 61  DEVTNGIVRERLAEDDAKDGFLLDGFPRTVEQAEELENILRDLGTELDAVINIDVEKDVL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     +    E   R DDK +    R+    K   
Sbjct: 121 MKRLTGRWICRTCGKTYHEIYNPPKVAGKCDLDGGELYQREDDKKETVENRLNVNMKQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y   G L+ I+G  D+++V   ++ +L S
Sbjct: 181 PLLDFYSAKGKLHSINGEQDINDVFVDVEKILAS 214


>gi|295838425|ref|ZP_06825358.1| adenylate kinase [Streptomyces sp. SPB74]
 gi|197695777|gb|EDY42710.1| adenylate kinase [Streptomyces sp. SPB74]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++KL+VP +STGD+ RA + + T LGK+ K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKKLSVPHISTGDLFRANISQGTELGKRAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+   D   GF+LDG+PR V QA++L   +      +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMGQADAAHGFLLDGFPRNVGQAEALDGILKEWGVTLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DDK +   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVTYSKPKQEGVCDVCGGELYQRDDDKEETVRKRLEVYHTET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  +YR    +  I  +  ++EV+ R++ +L
Sbjct: 181 EPIIDFYRAQDLVKTIPALGKVNEVTERALAAL 213


>gi|87124982|ref|ZP_01080829.1| Adenylate kinase [Synechococcus sp. RS9917]
 gi|86167302|gb|EAQ68562.1| Adenylate kinase [Synechococcus sp. RS9917]
          Length = 185

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 114/191 (59%), Gaps = 13/191 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL     +  LSTGD+LR+EV   T LG++ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCAAHGMQHLSTGDLLRSEVAAGTALGQEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           A+V  +V  ++ RL     G++LDG+PRTV QA++L   ++ +   ++AV+ L ++DA +
Sbjct: 64  ALVLAIVKGQLGRL--STGGWLLDGFPRTVAQAEALTPLLAELQQPLEAVLLLELDDAVL 121

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD   V   R+E YR+   PL  +YR  G L  ++    +
Sbjct: 122 IERMLAR----------GRADDTEAVIRHRLEVYREKTAPLIDFYRQQGLLCSVEAQGSI 171

Query: 181 DEVSRSIDSLL 191
           + +++ I++ L
Sbjct: 172 EAITKRIEATL 182


>gi|261822474|ref|YP_003260580.1| adenylate kinase [Pectobacterium wasabiae WPP163]
 gi|261606487|gb|ACX88973.1| adenylate kinase [Pectobacterium wasabiae WPP163]
          Length = 214

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KDAGIDVDYVIEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        + S+R DD+ D   KR+  Y +   
Sbjct: 117 IDRIIGRRVHAASGRVYHIKFNPPKVEDKDDVTGEDLSIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+   D G    + ++G   ++EV   ++++L
Sbjct: 177 PLVSYYQKEADAGNTRYFKVEGTRKVEEVRAELETIL 213


>gi|253687475|ref|YP_003016665.1| adenylate kinase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|259494012|sp|C6DB87|KAD_PECCP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|251754053|gb|ACT12129.1| adenylate kinase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 214

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     ++   +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KDVGINVDYVIEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        + ++R DD  D   KR+  Y +   
Sbjct: 117 IDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTIRKDDHEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+   D G    + ++G   ++EV   ++++L
Sbjct: 177 PLVSYYQKEADAGNTRYFKVEGTRKVEEVRAELETIL 213


>gi|254464788|ref|ZP_05078199.1| adenylate kinase [Rhodobacterales bacterium Y4I]
 gi|206685696|gb|EDZ46178.1| adenylate kinase [Rhodobacterales bacterium Y4I]
          Length = 227

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 22/212 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K    QLSTGD+LR  V   T  G   K  ME+G L+SD 
Sbjct: 12  LILLGPPGAGKGTQARMLEEKFGYVQLSTGDLLREAVAAGTPAGLAAKAVMEAGQLVSDE 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC  G ILDG+PRT  QA++L   ++  +  I+A I L V+DA+M +
Sbjct: 72  IVINILRDRLAKADCAKGVILDGFPRTTVQAEALDGLLAETNQKINAAISLEVDDAAMVE 131

Query: 123 RIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                        +   +E   R+DD  +    R+E Y     P
Sbjct: 132 RISGRYTCGGCGEGYHDSFKQPAEAGKCDKCGGTEMKRRADDNAETVASRLEAYHAQTAP 191

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
           L +YY   G L   D M  + ++++ + +++ 
Sbjct: 192 LIAYYGGKGVLQTTDAMGGIGDIAQDMAAIVT 223


>gi|68568760|sp|Q65UF7|KAD_MANSM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|52306903|gb|AAU37403.1| Adk protein [Mannheimia succiniciproducens MBEL55E]
          Length = 218

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 115/218 (52%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 5   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 64

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 65  DELTVALVKDRIAQPDCANGFLLDGFPRTIPQADAL----KDSGVNIDYVLEFDVPDEVI 120

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R+  Y K  
Sbjct: 121 VERMSGRRVHQ-ASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQT 179

Query: 159 LPLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++EVS  ++S+L
Sbjct: 180 QPLVDYYQAEANAGNTKYFRLDGTKKVEEVSAELNSIL 217


>gi|120555147|ref|YP_959498.1| adenylate kinase [Marinobacter aquaeolei VT8]
 gi|166219990|sp|A1U2U2|KAD_MARAV RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|120324996|gb|ABM19311.1| Adenylate kinase [Marinobacter aquaeolei VT8]
          Length = 217

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 107/187 (57%), Gaps = 25/187 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  ++++  +PQ+STGDMLRA V   + LG QVK  M SG L+S
Sbjct: 1   MRIIMLGAPGAGKGTQAQFITERFEIPQISTGDMLRAAVKAESELGLQVKEVMASGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI+ PDC +GF+LDG+PRT+ QA++L     +   AID V+E+ VED  +
Sbjct: 61  DDIIIALIEERIQQPDCKNGFLLDGFPRTIPQAEAL----KDQGIAIDYVVEISVEDEEI 116

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   RV E       V                    R DDK +   KR++ Y +   
Sbjct: 117 VSRLSGRRVHEGSGRIYHVKYDPPKVEGKDDETGEALIQREDDKEETVRKRLKIYHEQTA 176

Query: 160 PLSSYYR 166
           PL  +Y+
Sbjct: 177 PLVGFYQ 183


>gi|114567820|ref|YP_754974.1| adenylate kinase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317303|sp|Q0AUK1|KAD_SYNWW RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|114338755|gb|ABI69603.1| Adenylate kinase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 113/215 (52%), Gaps = 21/215 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L  +  +P +STGD+ R  V++ + LG++ +  M SG L+ 
Sbjct: 1   MNIILMGPPGAGKGTQAELLKARFPIPHISTGDIFRDAVNQGSELGQEAQKYMSSGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +V +RI   DCDSGF+LDG+PRT DQA++L   ++ +   +D  I + V    +
Sbjct: 61  DEITTAIVKERITQADCDSGFLLDGFPRTTDQAQALDQSLAELGKKVDLAINIDVPTQLL 120

Query: 121 FKRIQVRV---------------------LEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R+                      ++   E   R+DD+ +  +KR+E Y +   
Sbjct: 121 IERLSGRISCRECKRVYNLNFNPPREQGKCDSCGGELVQRNDDRGETVVKRLEVYNQQTR 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           PL  YY   G L+ I+G     +V   I   L S+
Sbjct: 181 PLLQYYEAQGVLFNIEGSRGSGQVFADIQEKLESL 215


>gi|307824480|ref|ZP_07654705.1| adenylate kinase [Methylobacter tundripaludum SV96]
 gi|307734464|gb|EFO05316.1| adenylate kinase [Methylobacter tundripaludum SV96]
          Length = 212

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 120/215 (55%), Gaps = 28/215 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PGSGKGTQA  +++K  +PQ+STGDMLRA V   T LG + K  M++G L+S
Sbjct: 1   MRIILLGSPGSGKGTQAQFITEKYAIPQISTGDMLRAAVREGTPLGVEAKKVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI   DC +GF+LDG+PRT+ QA+ L+     M  +ID VIE+ VED  +
Sbjct: 61  DDIILGLIKERITQADCANGFLLDGFPRTIAQAEGLN----EMGVSIDTVIEIVVEDEEI 116

Query: 121 FKRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+                    +V  ++ +  E  + R DDK +   KR+  Y +   
Sbjct: 117 VKRMAGRRVHLQSGRTYHVEFNPPKVEGVDDVTGEPLIQRDDDKEETVRKRLSVYHEQTK 176

Query: 160 PLSSYY---RDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y           I G+  +DE+++ + ++L
Sbjct: 177 PLVGFYSAPEQQVKFSSIAGVGSVDEITKKVFAVL 211


>gi|310659481|ref|YP_003937202.1| adenylate kinase [Clostridium sticklandii DSM 519]
 gi|308826259|emb|CBH22297.1| adenylate kinase [Clostridium sticklandii]
          Length = 226

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 111/216 (51%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +  +  VP +STGD+ R  +  NT LG++ K  M+ G L+ 
Sbjct: 11  MRLILLGPPGAGKGTQASGIVDRYKVPHISTGDIFRKNIKENTELGRKAKEYMDKGLLVP 70

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR++  D   GF+LDG+PRT +QA++L   +  MD  +D VI + V+ + +
Sbjct: 71  DELVVAIVEDRLKEADASEGFLLDGFPRTENQAQALDTALEKMDTKLDKVINIEVDKSIL 130

Query: 121 FKRI---------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R                      Q  + +    E   RSDD  +   KRIE Y     
Sbjct: 131 VGRAVGRRICKNCGATYHIEFNKPKQEGICDLCQGELFQRSDDTEETVSKRIEVYLNETQ 190

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY     L  IDG  D+++V   I S L S +
Sbjct: 191 PLIDYYTKKDILVTIDGQQDINKVLEDIVSALGSEK 226


>gi|297588212|ref|ZP_06946856.1| adenylate kinase [Finegoldia magna ATCC 53516]
 gi|297574901|gb|EFH93621.1| adenylate kinase [Finegoldia magna ATCC 53516]
          Length = 215

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA R+ ++ ++P +STGD+ R  +   T LG++V+G +  G L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAKRVIEEFDIPHISTGDIFRKNIKEKTELGQKVEGLLAEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+   DC +GF+LDG+PRT+ QA++L   ++     +D V+ + V+  S+
Sbjct: 61  DELTIEMVWDRLDQEDCKNGFLLDGFPRTIPQAEALDEGLAKRGLKLDRVLNIDVDKDSL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     + +   +    R DDK    L RI+ Y     
Sbjct: 121 VKRLSGRRVCPNCGASYHIDNNPTKVEGICDVCQTPVIQREDDKEQTVLDRIKVYDSQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     ++ +DG L +DE++  +
Sbjct: 181 PLVDFYNKQDLVFTVDGTLPIDEITNKL 208


>gi|225376429|ref|ZP_03753650.1| hypothetical protein ROSEINA2194_02071 [Roseburia inulinivorans DSM
           16841]
 gi|225211805|gb|EEG94159.1| hypothetical protein ROSEINA2194_02071 [Roseburia inulinivorans DSM
           16841]
          Length = 214

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 114/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  VP +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIADKYGVPHISTGDIFRANIKNGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  DC +GFILDG+PRT+ QA++L A +  +   +D  I++ V D ++
Sbjct: 61  DELTCDLVMDRIQQDDCKNGFILDGFPRTIPQAEALTAALEKIGQKMDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   S   +R DDK +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLNCGATYHIVSIPTKVEGICDRCGSPVVLRDDDKPETVQKRLSVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+    L  +DG   M++V   I ++L
Sbjct: 181 PLIDYYKAQNILKTVDGTQPMEKVFADIVAIL 212


>gi|307294995|ref|ZP_07574837.1| adenylate kinase [Sphingobium chlorophenolicum L-1]
 gi|306879469|gb|EFN10687.1| adenylate kinase [Sphingobium chlorophenolicum L-1]
          Length = 218

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 112/213 (52%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL     + QLSTGDMLRA V   T +G + K  ME+G L+S
Sbjct: 1   MNIILLGPPGAGKGTQATRLVDSRAMVQLSTGDMLRAAVKAGTPIGLKAKAVMEAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ + +     ++G I DGYPRT  QA SL   +++ +  +D VIEL V++ ++
Sbjct: 61  DEIVSGIIGEALDALAPETGVIFDGYPRTEAQAHSLDGILADRNRTLDHVIELEVDEDAL 120

Query: 121 FKRIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTI 158
            +RI  R   A   E                         R DD  +    R+  YR   
Sbjct: 121 VERITGRFTCATCGEGYHDRFKMPKVEGSCDKCGGHEFKRRPDDNEETVRTRMAEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+   Y   G +  +DGM DMD+V+ +I ++L
Sbjct: 181 APILPIYEARGIVSRVDGMADMDDVTVAIAAIL 213


>gi|159042862|ref|YP_001531656.1| adenylate kinase [Dinoroseobacter shibae DFL 12]
 gi|157910622|gb|ABV92055.1| adenylate kinase [Dinoroseobacter shibae DFL 12]
          Length = 213

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 117/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L ++  + QLSTGDMLR      T +G++V   M+ G L++
Sbjct: 1   MNIILLGPPGAGKGTQARKLVEERGMTQLSTGDMLREARTSGTEMGQRVAEVMDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++   +   GFI DG+PRT+ QA +L A +  +  ++DAVIE+RV+DA++
Sbjct: 61  DEIVIGLIEEKL-AGEAGGGFIFDGFPRTLAQADALGALLDKLGQSLDAVIEMRVDDAAL 119

Query: 121 FKRIQVR------------VLEAI----------ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R             L  I          AS+   R+DD  +   +R+  Y K  
Sbjct: 120 VARIAGRATCGGCGEVYNDTLRPIPADGKCGNCGASDFKRRADDNEESLKQRLMEYYKKT 179

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DGM  MD V+  I + L
Sbjct: 180 SPLIGYYHAKGTLRPVDGMGAMDAVASEIAAAL 212


>gi|237736191|ref|ZP_04566672.1| adenylate kinase [Fusobacterium mortiferum ATCC 9817]
 gi|229421744|gb|EEO36791.1| adenylate kinase [Fusobacterium mortiferum ATCC 9817]
          Length = 213

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L +K  +PQ+STGD+LRA +   T +G + K  M+ G L+ 
Sbjct: 1   MNIMLFGAPGAGKGTQAKFLIEKYGIPQISTGDILRAAIKEGTAMGLEAKKFMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC  GFILDG+PRT+ QA++L   + +M  A+D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLSQEDCKKGFILDGFPRTLAQAEALEVLMKDMGIALDKVISLNVPDELI 120

Query: 121 FKRIQVRVLEAI---------------------ASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +  +                      +E   R DD  +   KR+  Y     
Sbjct: 121 VGRVTGRKVCPVCGASFHVEFNPPKVEGKCDYCGAELITRKDDNAETVTKRLGEYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+    L  IDG  ++D +++ I ++L
Sbjct: 181 PLFDFYKSRNLLVDIDGTKEVDAITQEIFAIL 212


>gi|326777228|ref|ZP_08236493.1| adenylate kinase [Streptomyces cf. griseus XylebKG-1]
 gi|326657561|gb|EGE42407.1| adenylate kinase [Streptomyces cf. griseus XylebKG-1]
          Length = 219

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 115/216 (53%), Gaps = 23/216 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L+Q L++P ++TGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAQNLSIPHIATGDLFRANISQGTDLGKQARAYMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+   D   GF+LDG+PR V QA++L   + +    +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMAQSDAAGGFLLDGFPRNVGQAEALDVMLKDEGVKLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +A   E   R DD  +    R+E Y    
Sbjct: 121 VKRIAGRRVCRNNSAHVFHLTYNPPKAEGVCDACGGELYQRDDDSEETVRTRLEVYHTQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSLLVS 193
            P+  YYR  G +  I  +  + +V+ R++++L  S
Sbjct: 181 EPIIDYYRAQGLVVTISALGKVADVTARAMEALKAS 216


>gi|161510991|ref|YP_087988.2| adenylate kinase [Mannheimia succiniciproducens MBEL55E]
          Length = 214

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 115/218 (52%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRIAQPDCANGFLLDGFPRTIPQADAL----KDSGVNIDYVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R+  Y K  
Sbjct: 117 VERMSGRRVHQ-ASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQT 175

Query: 159 LPLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++EVS  ++S+L
Sbjct: 176 QPLVDYYQAEANAGNTKYFRLDGTKKVEEVSAELNSIL 213


>gi|170780753|ref|YP_001709085.1| adenylate kinase [Clavibacter michiganensis subsp. sepedonicus]
 gi|259493992|sp|B0RB59|KAD_CLAMS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|169155321|emb|CAQ00424.1| adenylate kinase [Clavibacter michiganensis subsp. sepedonicus]
          Length = 200

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 116/199 (58%), Gaps = 6/199 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA R++    +P +STGD+ R  +   T LG+QV+  +++G+ + D
Sbjct: 3   RLLIVGPPGAGKGTQAKRIAADRGIPDVSTGDIFRQNIKDRTELGQQVQALVDAGNYVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V  R++  D  +GF+LDGYPRT+ Q   L   +      +DAVI+L  ++  + 
Sbjct: 63  ELTNRLVTVRLQEEDAQAGFLLDGYPRTLAQVAYLEELLQGWGQELDAVIQLVADEDEVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A+E+  R+DD  D    R E Y +   PL   YR+ G L  +DG+ ++D
Sbjct: 123 ARLTRR-----AAEQG-RADDGEDEIRHRQEVYVRETSPLIDVYREHGLLVEVDGLGEVD 176

Query: 182 EVSRSIDSLLVSVRKKCSS 200
           EV+  I + L +   + SS
Sbjct: 177 EVAERIRTALAARGVRPSS 195


>gi|52549652|gb|AAU83501.1| adenylate kinase and related kinases [uncultured archaeon
           GZfos29E12]
          Length = 217

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  GPPGSGKGTQA  L++K  VP +STGD+LR  + + T LG + K  M+ G L+ 
Sbjct: 1   MIIVLFGPPGSGKGTQAKLLAEKYGVPHISTGDILRENLKKETKLGLEAKTYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ DR+   DC SGF+LDGYPRT+ QA++L   ++ +   +D V+ + V D  +
Sbjct: 61  DDLLIGLIKDRLSESDCASGFLLDGYPRTLPQAETLSKILTELGKNLDVVLNIDVPDEKL 120

Query: 121 FKRI--------------------QVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
            KR+                    Q  + +   S+   R DDK +  L R++ Y+    P
Sbjct: 121 LKRLAGRRMCVCGASYHILFNKPKQAGICDLCGSKLYQRDDDKEEAILNRLDVYKNQTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  +Y   G +  I+G  D++ V   I  +L
Sbjct: 181 LIDHYTQAGVMLTINGAADIEVVFNGICRML 211


>gi|19704633|ref|NP_604195.1| adenylate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
 gi|22653801|sp|Q8RE31|KAD_FUSNN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|19714935|gb|AAL95494.1| Adenylate kinase [Fusobacterium nucleatum subsp. nucleatum ATCC
           25586]
          Length = 211

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 112/207 (54%), Gaps = 16/207 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + ++  G PG+GKGTQA  +  K  +PQ+STGD+LR  V   T LG + K  M++G L+ 
Sbjct: 4   LNLVLFGAPGAGKGTQAKFIVDKYGIPQISTGDILRVAVANKTKLGLEAKKFMDAGQLVP 63

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IVN +V +R+   DC+ GFI+DG+PR V QAK L   ++ +   I+ VI L V D  +
Sbjct: 64  DEIVNGLVAERLAEKDCEKGFIMDGFPRNVAQAKVLDEILTKLGKQIEKVIALNVPDKDI 123

Query: 121 FKRIQVRVLEAIAS------------EKS----VRSDDKYDVFLKRIENYRKTILPLSSY 164
            +RI  R    +              EK      R+DD  +V +KR+E Y     P+  Y
Sbjct: 124 IERITGRRTSKVTGKIYHIKFNPPVDEKPEDLVQRADDTEEVVVKRLETYHNQTAPVLDY 183

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           Y+    +  IDG   ++++++ I  +L
Sbjct: 184 YKVQNKVTEIDGTKKLEDITQDIFKIL 210


>gi|34328230|ref|NP_058591.2| adenylate kinase 2, mitochondrial isoform b [Mus musculus]
 gi|12846743|dbj|BAB27286.1| unnamed protein product [Mus musculus]
 gi|14250357|gb|AAH08610.1| Adenylate kinase 2 [Mus musculus]
 gi|74185113|dbj|BAE39159.1| unnamed protein product [Mus musculus]
 gi|123248047|emb|CAM19114.1| adenylate kinase 2 [Mus musculus]
 gi|187466291|emb|CAQ51907.1| adenylate kinase 2 [Mus musculus]
          Length = 232

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDIVFASI 223


>gi|258514616|ref|YP_003190838.1| adenylate kinase [Desulfotomaculum acetoxidans DSM 771]
 gi|257778321|gb|ACV62215.1| adenylate kinase [Desulfotomaculum acetoxidans DSM 771]
          Length = 213

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 107/204 (52%), Gaps = 21/204 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++ +GPPG+GKGTQA  L +++ +  +STGDM RA +   T +GK+ K  M+ G L+ 
Sbjct: 1   MNLLIMGPPGAGKGTQAEVLVKEMAITHISTGDMFRAAIKEGTEMGKKAKEFMDQGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+  PDC  GF+LDG+PRTVDQAK+L   +S M   ID+VI + V    +
Sbjct: 61  DEVVIGMVKDRLSQPDCAKGFLLDGFPRTVDQAKALDETLSAMGIKIDSVINVEVAREKL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +                      +   E   RSDD  +    R++ Y     
Sbjct: 121 MARLTGRRVCRNCGASYHVIFNPTKEADKCNSCGGETYQRSDDNEETVGNRLDVYEAQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEV 183
           PL  YY   G L  IDG  D+ +V
Sbjct: 181 PLIDYYGKQGLLKNIDGDQDIKKV 204


>gi|239918179|ref|YP_002957737.1| Adenylate kinase [Micrococcus luteus NCTC 2665]
 gi|281415631|ref|ZP_06247373.1| Adenylate kinase [Micrococcus luteus NCTC 2665]
 gi|417204|sp|P33107|KAD_MICLU RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|259494011|sp|C5CC42|KAD_MICLC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|44436|emb|CAA35568.1| Adk protein [Micrococcus luteus]
 gi|239839386|gb|ACS31183.1| Adenylate kinase [Micrococcus luteus NCTC 2665]
          Length = 205

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 113/199 (56%), Gaps = 6/199 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPGSGKGTQA R++ KL +  +STGD+ R  V   T LG + K  +++G  + D
Sbjct: 3   RMLLMGPPGSGKGTQATRIADKLGIVPISTGDIFRHNVKSMTPLGVEAKRYIDNGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V DRI   D + GF+LDGYPRT  Q ++L A ++    ++ AV+EL V D  + 
Sbjct: 63  EVTNRMVADRIAQADAEHGFLLDGYPRTKGQVEALDAMLAEAGQSLSAVVELEVPDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R      +E   R+DD  +V   R++ Y +    +   Y + G +  +DG   +D
Sbjct: 123 ERLLKR------AEIEGRADDTQEVIEHRLDLYHRETESVIQEYVERGIVARVDGTGQID 176

Query: 182 EVSRSIDSLLVSVRKKCSS 200
           +V+  +   + SVR    S
Sbjct: 177 DVTERLLQAVYSVRSATGS 195


>gi|77020262|ref|NP_001029138.1| adenylate kinase 2, mitochondrial isoform a [Mus musculus]
 gi|224471907|sp|Q9WTP6|KAD2_MOUSE RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|26340846|dbj|BAC34085.1| unnamed protein product [Mus musculus]
 gi|123248046|emb|CAM19113.1| adenylate kinase 2 [Mus musculus]
 gi|187466290|emb|CAQ51906.1| adenylate kinase 2 [Mus musculus]
          Length = 239

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDIVFASI 223


>gi|253581367|ref|ZP_04858593.1| adenylate kinase [Fusobacterium varium ATCC 27725]
 gi|251836731|gb|EES65265.1| adenylate kinase [Fusobacterium varium ATCC 27725]
          Length = 213

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 109/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L +K  +PQ+STGD+LRA +   T +G + K  M+ G L+ 
Sbjct: 1   MNIMLFGAPGAGKGTQAKFLIEKYGIPQISTGDILRAAIKEGTAMGLEAKKFMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC  GFILDG+PRT+ QA++L   +  M   +D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLSQDDCKKGFILDGFPRTLAQAEALEVLMKEMGIKLDKVISLNVPDELI 120

Query: 121 FKRIQVRVLEAI---------------------ASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R +  +                      ++   R DD  +   KR+  Y     
Sbjct: 121 LGRIVGRKVCPVCGASFHIKFNPPKVEGKCDLCGADLITRKDDNEETVTKRLTEYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+  G L  IDG   M+E+++ I  +L
Sbjct: 181 PLFDFYQSRGVLVDIDGTKKMEEITKEIFDIL 212


>gi|163856985|ref|YP_001631283.1| adenylate kinase [Bordetella petrii DSM 12804]
 gi|226741851|sp|A9IQ39|KAD_BORPD RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|163260713|emb|CAP43015.1| adenylate kinase [Bordetella petrii]
          Length = 218

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 107/186 (57%), Gaps = 25/186 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  ++Q   +PQ+STGDMLRA V + T LG++ K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAAFVTQHFAIPQISTGDMLRAAVKQGTPLGQEAKKVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DR++ PDC +G++ DG+PRT+ QA +L     +   A+D V+E+ V +  +
Sbjct: 61  DEIIIGLVQDRLKQPDCANGYLFDGFPRTIPQADAL----KSAGVALDYVVEIEVPEDDI 116

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     L+ +  E  V R DD+ D    R+  Y+K   
Sbjct: 117 IERMSGRRVHPASGRSYHVRFNPPKQEGLDDVTGEPLVQRDDDREDTVRNRLAVYQKQTR 176

Query: 160 PLSSYY 165
           PL  YY
Sbjct: 177 PLVDYY 182


>gi|303257719|ref|ZP_07343731.1| adenylate kinase [Burkholderiales bacterium 1_1_47]
 gi|302859689|gb|EFL82768.1| adenylate kinase [Burkholderiales bacterium 1_1_47]
          Length = 217

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 117/216 (54%), Gaps = 34/216 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA R+ +   +PQ+STGDMLRA V   T LG   K  M++G L+S
Sbjct: 1   MRLILLGAPGAGKGTQAARICEHYGIPQISTGDMLRAAVKAGTPLGLAAKKIMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R+  PDC +GF+ DG+PRT+ QA++L          ID V+E+ V D  +
Sbjct: 61  DDIIIGLVKERLEKPDCKNGFLFDGFPRTIPQAEAL----VKAGIPIDDVVEIAVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            KR+  R +  +AS ++                       R DDK +   KR+E Y    
Sbjct: 117 LKRMSGRRVH-VASGRTYHVKFNPPKVEGVDDVTGEPLIQRPDDKEETVKKRLEVYHTQT 175

Query: 159 LPLSSYYR------DMGCLYI-IDGMLDMDEVSRSI 187
             L  +Y+      D    YI IDG+ D++EVSR I
Sbjct: 176 EALVGFYQSLAAKGDSKTKYIKIDGVGDVNEVSRRI 211


>gi|302519639|ref|ZP_07271981.1| adenylate kinase [Streptomyces sp. SPB78]
 gi|318058107|ref|ZP_07976830.1| adenylate kinase [Streptomyces sp. SA3_actG]
 gi|318076040|ref|ZP_07983372.1| adenylate kinase [Streptomyces sp. SA3_actF]
 gi|302428534|gb|EFL00350.1| adenylate kinase [Streptomyces sp. SPB78]
          Length = 215

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++KL++P +STGD+ RA + + T LGK+ K  M++G+L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAFLAKKLSIPHISTGDLFRANISQGTELGKRAKSYMDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +  DR+   D  +GF+LDG+PR V QA++L   +      +DAV++L V +  +
Sbjct: 61  DEVTIGMAKDRMEQEDAANGFLLDGFPRNVGQAEALDGILKEWGVRLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DDK +   KR+E Y    
Sbjct: 121 VKRIAGRRICRNDSSHVFHVTYSKPKQEGVCDVCGGELYQRDDDKEETVRKRLEVYHTET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
            P+  +YR    +  I  +  ++EV+ R++ +L
Sbjct: 181 EPIIDFYRAQDLVKTIPALGKVNEVTERALAAL 213


>gi|148263160|ref|YP_001229866.1| adenylate kinase [Geobacter uraniireducens Rf4]
 gi|189046018|sp|A5GAW3|KAD_GEOUR RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|146396660|gb|ABQ25293.1| Adenylate kinase [Geobacter uraniireducens Rf4]
          Length = 217

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA  L ++  +PQ+STGD+LRA V   T +G + KG MESG+L+ 
Sbjct: 1   MNLILLGPPGAGKGTQAKLLIKRFQIPQISTGDILRAAVSEMTPMGVKAKGYMESGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DC +GFILDG+PRTV QA +L   +  M+ +I+ V+ + V+   +
Sbjct: 61  DEVVVGIVRERLEKNDCLNGFILDGFPRTVAQADALKHMLVCMNMSIEHVVSMAVDKEEL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                       +    E   R DD+ +   KR++ Y     
Sbjct: 121 LQRITGRRTCRLCGKGYHVVFDPPRVSGRCDECLGELFQRDDDQEETMRKRLDVYEDQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY +   L  I G+  +D++ + I S++
Sbjct: 181 PLITYYENESLLRSIAGVGSIDDIQQRILSII 212


>gi|332180483|gb|AEE16171.1| Adenylate kinase [Treponema brennaborense DSM 12168]
          Length = 210

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 111/197 (56%), Gaps = 26/197 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+ IFLGPPG+GKGT A ++++  N+P +STG++ RA +   T LGK+V+  +++GSL+S
Sbjct: 1   MKFIFLGPPGAGKGTLAAKVAESYNIPHISTGEIFRAAIKAQTPLGKKVQAIIDAGSLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I  ++V +R+  PD   GFILDG+PRT+ QA++L   +      ++AV+   + D  +
Sbjct: 61  DDITIELVRERLSQPDAQKGFILDGFPRTIPQAEALEGIVP-----VNAVVNFDIADKEV 115

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + ++  +E  +R DDK +    R+E YR+   
Sbjct: 116 VERLSGRRVCRNCGQNYHVKFMPPAHEGICDSCKAELYIRDDDKIEAITHRLEVYREQTA 175

Query: 160 PLSSYYRDMGCLYIIDG 176
           PL  +YR+   L  ID 
Sbjct: 176 PLIDFYRNKKVLTDIDA 192


>gi|258545819|ref|ZP_05706053.1| adenylate kinase [Cardiobacterium hominis ATCC 15826]
 gi|258518963|gb|EEV87822.1| adenylate kinase [Cardiobacterium hominis ATCC 15826]
          Length = 178

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 109/192 (56%), Gaps = 14/192 (7%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LG PGSGKGTQA  L ++  +  LSTGDMLRAE+  ++ LG+Q K  MESG+L+S
Sbjct: 1   MNIILLGAPGSGKGTQAAFLIEQHGLTHLSTGDMLRAEIAADSDLGRQAKSIMESGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++  R+     + G + DG+PRT+ QA++L   ++     ID VIEL+V++  +
Sbjct: 61  DDIVIAMIAARL----SEKGALFDGFPRTIAQAEALDKLLAGRGSQIDRVIELQVDNEEI 116

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            KR+  R           RSDD  +    R+  +     PL +YY   G L  IDG  ++
Sbjct: 117 VKRMLAR----------GRSDDNEETIRNRLAVFEAQTKPLIAYYETQGKLRSIDGSGEL 166

Query: 181 DEVSRSIDSLLV 192
           D +   I++ L 
Sbjct: 167 DAIRARIEAALA 178


>gi|33864018|ref|NP_895578.1| adenylate kinase [Prochlorococcus marinus str. MIT 9313]
 gi|46396097|sp|Q7V526|KAD_PROMM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|33635602|emb|CAE21926.1| Adenylate kinase [Prochlorococcus marinus str. MIT 9313]
          Length = 182

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 111/195 (56%), Gaps = 19/195 (9%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL     +  LSTGD+LR EV   T LG++    M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAERLCAAHELMHLSTGDLLRTEVGAKTPLGQEAAAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V ++++  + + G++LDG+PRT+ QAK+L   +  +   I+AV+ L + DA + 
Sbjct: 64  ELVLAIVENQLK--NQNGGWLLDGFPRTLIQAKALEPLLEELKQPIEAVVLLELNDAVLI 121

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           RSDD   V   R+E YR+   PL  +YR  G L  +       
Sbjct: 122 ERLISRG----------RSDDNESVIRNRLEVYREKTAPLIDHYRQQGLLQTV------- 164

Query: 182 EVSRSIDSLLVSVRK 196
           E   SI+S+ +S+ K
Sbjct: 165 EAHGSIESIAISIEK 179


>gi|254468421|ref|ZP_05081827.1| adenylate kinase [beta proteobacterium KB13]
 gi|207087231|gb|EDZ64514.1| adenylate kinase [beta proteobacterium KB13]
          Length = 211

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 116/209 (55%), Gaps = 29/209 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LG PG+GKGTQA  L+ +  +PQ+STGDMLRA V   T LG + K  M+ G L+ 
Sbjct: 1   MNIILLGAPGAGKGTQASFLNNQYQIPQISTGDMLRAAVSNKTELGIEAKNYMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+++  +V +RI   DC +GF+LDG+PRT++QAK+    I +    ID V+ + V D  +
Sbjct: 61  DSLIINLVKERIGHEDCKNGFMLDGFPRTINQAKA----IDDAKIQIDYVVSISVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS ++                      +R DDK +  + R++NY +  
Sbjct: 117 VERLSGRRVHP-ASGRTYHIKFNPPKNDNKDDVTNEDLIIRDDDKKETIMTRLKNYHEAT 175

Query: 159 LPLSSYYRDMGCLYI--IDGMLDMDEVSR 185
            PL  YY++   L    IDG L ++ +++
Sbjct: 176 KPLEDYYKNKSKLNFIDIDGTLQIESINQ 204


>gi|323456169|gb|EGB12036.1| hypothetical protein AURANDRAFT_58655 [Aureococcus anophagefferens]
          Length = 245

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 111/219 (50%), Gaps = 32/219 (14%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I  GPPGSGKGT A +L +KL  PQLSTGDMLRA V   T +G+Q K  M SG L+SD 
Sbjct: 29  VILFGPPGSGKGTHAPKLVEKLGAPQLSTGDMLRAAVAAGTEVGRQAKDVMASGGLVSDE 88

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI   DC SGFILDG+PRTV+QAK L   +      ++AVI L V D  + +
Sbjct: 89  IVVGIIKDRIAEDDCKSGFILDGFPRTVEQAKMLDDCLGATKECVNAVIALEVPDEILTE 148

Query: 123 RIQVRVLE---------AIASEKSV---------------------RSDDKYDVFLKRIE 152
           RI  R +            A  KS+                     R+DD  D    R+ 
Sbjct: 149 RICGRWVHKASGRSYHATFAPPKSLDGRKPTEETMLDDETGEPLMQRADDTEDALKARLA 208

Query: 153 NYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            Y    +P+  +Y  +  +  +D    +DEV   I+  +
Sbjct: 209 GYHDQTVPILDHYSTV--VSKVDANQGLDEVWTDIEKAI 245


>gi|303240951|ref|ZP_07327462.1| adenylate kinase [Acetivibrio cellulolyticus CD2]
 gi|302591537|gb|EFL61274.1| adenylate kinase [Acetivibrio cellulolyticus CD2]
          Length = 215

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ LG PGSGKGTQA  +S+   +P +STGD+ R+ +   T LGK+ K  ++ G L+ 
Sbjct: 1   MKVVLLGAPGSGKGTQAVNISEWYKIPHISTGDIFRSNIKNGTELGKKAKEYIDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR++  DC+ GFILDG+PRTV QA+ L   ++ M   +D V+ + V D+ +
Sbjct: 61  DEVTIDIVSDRLKQSDCEKGFILDGFPRTVYQAEKLDEILNEMGATLDVVLNIEVPDSEI 120

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
             R+  R           V+    +E +V          R DD+ +  L+R+  Y K   
Sbjct: 121 ITRMGGRRVCTKCGMSYHVVFNPPAEGNVCKNCGEVVIQREDDREETVLQRLSTYHKQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  ++G  ++D+ +  +   L
Sbjct: 181 PLIEYYEKDNKLVTVEGQDNIDDTTSCVKKAL 212


>gi|302388732|ref|YP_003824553.1| Adenylate kinase [Thermosediminibacter oceani DSM 16646]
 gi|302199360|gb|ADL06930.1| Adenylate kinase [Thermosediminibacter oceani DSM 16646]
          Length = 216

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA +L++  +VP +STGDMLR+ V   T LGK+ +  M+ G L+ 
Sbjct: 1   MRIVLMGPPGAGKGTQAKKLAEAFDVPHISTGDMLRSAVQEGTPLGKKAREYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+R   C+ GFILDG+PRT+ QA+SL   +  M   +DAV+ + V    +
Sbjct: 61  DEVITGIVRERLRDKSCEKGFILDGFPRTIPQAESLEEALGEMGIRLDAVVNIVVPREEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     + +    +  +R+DD       RI  Y +   
Sbjct: 121 IERFTGRRVCEVCGFTYHVKYNPPQKEGICDKCGGKLIMRADDDVKTVENRINVYEQQTR 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  IDG   +D V   I S L
Sbjct: 181 PLIEYYDRKNLLVNIDGNRPIDVVFEDIKSRL 212


>gi|251790615|ref|YP_003005336.1| adenylate kinase [Dickeya zeae Ech1591]
 gi|247539236|gb|ACT07857.1| adenylate kinase [Dickeya zeae Ech1591]
          Length = 214

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KDAGITVDHVIEFDVPDELI 116

Query: 121 FKRIQVRVLEAIAS---------------------EKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A +                      + ++R DD+ D   KR+  Y +   
Sbjct: 117 IERIIGRRVHAASGRVYHVTFNPPKVEGKDDVTGDDLTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+          + IDG   ++EVS  +  +L
Sbjct: 177 PLVNYYQQEAAANHTRYHKIDGTRPVNEVSSELARIL 213


>gi|300742037|ref|ZP_07072058.1| adenylate kinase (ATP-AMP transphosphorylase) [Rothia dentocariosa
           M567]
 gi|300381222|gb|EFJ77784.1| adenylate kinase (ATP-AMP transphosphorylase) [Rothia dentocariosa
           M567]
          Length = 187

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 114/186 (61%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA +++++L +P +STGD+ R  +   T LGK+ K  ++SG+L+ D
Sbjct: 3   RLLIIGPPGAGKGTQAVKIAEELKIPAISTGDIFRKNIKEETELGKEAKSYIDSGNLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N +V  R+   D   GF+LDGYPR + Q   L A +++ +  ID V+ L  ++  + 
Sbjct: 63  SVTNNMVRARLDEADAAHGFLLDGYPRNIAQVHELDAILADKNQQIDRVLLLVADNDELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A+E+  R+DD  +V   R++ Y +   PL + YR+ G +  +DG+ ++ 
Sbjct: 123 ARLLNR-----AAEQG-RTDDNEEVIRHRLKVYEEETAPLIAIYRERGIVKEVDGLGEIA 176

Query: 182 EVSRSI 187
           +V+  I
Sbjct: 177 DVTERI 182


>gi|116749011|ref|YP_845698.1| adenylate kinases [Syntrophobacter fumaroxidans MPOB]
 gi|166220002|sp|A0LIL1|KAD_SYNFM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|116698075|gb|ABK17263.1| Adenylate kinase [Syntrophobacter fumaroxidans MPOB]
          Length = 213

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 109/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA RL  K  +PQ+STGDMLRA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNIILLGPPGAGKGTQASRLIGKYAIPQISTGDMLRAALKEGTPLGLEAKKYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++V  +V +RI+ PDC  G++LDG+PR V QA++L   +  +   ID V+ + V +  +
Sbjct: 61  DSVVIGLVKERIQKPDCSKGYMLDGFPRNVSQAEALDMMLGELKQRIDGVVCIEVPNKEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                       +    E   R DD       R++ Y     
Sbjct: 121 LGRLTGRRTCRSCGAGFHVMFDPPKTDGKCDKCGGELYQRDDDNEATVSSRLKVYEDQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  IDG+  MD +   I ++L
Sbjct: 181 PLIDYYEKQGKLRRIDGVGSMDAIFGRITAIL 212


>gi|146278547|ref|YP_001168706.1| adenylate kinase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556788|gb|ABP71401.1| Adenylate kinase [Rhodobacter sphaeroides ATCC 17025]
          Length = 217

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 118/211 (55%), Gaps = 23/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA RL +   + QLSTGDMLR      + +G++    M+ G L++D 
Sbjct: 4   VILLGPPGAGKGTQAKRLEESRGMVQLSTGDMLREAKTSGSEMGRRAAEVMDRGELVTDD 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ ++++ P    GFI DG+PRT+ QA +L   ++ M   +DAVIE++V+DA++  
Sbjct: 64  IVIGLIREKLQSP-AAGGFIFDGFPRTLKQADALGELLAQMGQGLDAVIEMQVDDAALVA 122

Query: 123 RIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                  +E +     +++   R+DD  +   KR+  Y K   P
Sbjct: 123 RITGRYSCGNCGAVYHDETKPTKVEGVCDVCGSTDLRRRADDTAEALSKRLMEYYKKTSP 182

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY   G L  +DG+ +MDEV+ +I  +L
Sbjct: 183 LIGYYYAKGQLSTVDGLAEMDEVTAAIAKVL 213


>gi|260886897|ref|ZP_05898160.1| adenylate kinase [Selenomonas sputigena ATCC 35185]
 gi|330839305|ref|YP_004413885.1| adenylate kinase [Selenomonas sputigena ATCC 35185]
 gi|260863496|gb|EEX77996.1| adenylate kinase [Selenomonas sputigena ATCC 35185]
 gi|329747069|gb|AEC00426.1| adenylate kinase [Selenomonas sputigena ATCC 35185]
          Length = 214

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 107/212 (50%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA  L ++  +P +STGDM RA V   T LG Q K  M++G L+ 
Sbjct: 1   MHILLMGPPGAGKGTQAANLVKEFGIPHISTGDMFRAAVKEGTELGLQAKACMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC  GFILDG+PRT +QA +L   +  +  ++ A + + V  A +
Sbjct: 61  DEVTIGIVKERLAKPDCKKGFILDGFPRTAEQADALTGILKELGLSLTAALNITVPAADL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     V +  A +   R+DD  +    R+  Y     
Sbjct: 121 IERAVGRRICKSCGATYHVKFNPSKKAGVCDTCAGDLYQRADDSEETMKNRLSVYEAQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY   G    IDG   +D+V  ++ + L
Sbjct: 181 PLIAYYEKAGVYKEIDGRQPIDDVKAAMIAAL 212


>gi|218290784|ref|ZP_03494861.1| Adenylate kinase [Alicyclobacillus acidocaldarius LAA1]
 gi|218239219|gb|EED06419.1| Adenylate kinase [Alicyclobacillus acidocaldarius LAA1]
          Length = 216

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 119/217 (54%), Gaps = 22/217 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I +G PG+GKGTQA R+ ++  +P +STGDM RA +   + LG++VKG ++SG L+ 
Sbjct: 1   MQVILIGLPGAGKGTQAARIQEEFGIPHISTGDMFRAAIASRSGLGQEVKGYLDSGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D    +VV +R+  PD   GF+LDG+PRT+ QA +L A +  +   +D V+ + V  A +
Sbjct: 61  DETTVKVVRERLSQPDAQKGFLLDGFPRTIGQATALDALLDELARPLDVVLYIEVYPAVL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +    E   R DD  +    R++ +++T  
Sbjct: 121 MERITGRRICKGCGATYHVVYQPPKVSSVCDKCGGELYQRQDDTEEAVATRLDQFKQT-E 179

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL ++Y + G L  IDG   +++V R +   L S+++
Sbjct: 180 PLIAFYEERGLLKRIDGSRSIEDVYRDMTEALASLKR 216


>gi|315634545|ref|ZP_07889830.1| adenylate kinase [Aggregatibacter segnis ATCC 33393]
 gi|315476772|gb|EFU67519.1| adenylate kinase [Aggregatibacter segnis ATCC 33393]
          Length = 214

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLR+ +   T LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFAIPQISTGDMLRSAIKAGTELGKQAKTLMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+  PDC  GF+LDG+PRT+ QA +L     +   AID V+E  V D  +
Sbjct: 61  DDLIISLVKERVAQPDCTKGFLLDGFPRTIPQADAL----KSAGIAIDYVLEFDVPDEVI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +    +  +R+DDK +  L R++ Y  T  
Sbjct: 117 VERMSGRRVHQPSGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLKVYHNTTK 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + +DG   +++VS+++D +L
Sbjct: 177 PLVDYYQAEAKAGNTQYFRLDGTQKVEDVSKALDKIL 213


>gi|297537783|ref|YP_003673552.1| adenylate kinase [Methylotenera sp. 301]
 gi|297257130|gb|ADI28975.1| adenylate kinase [Methylotenera sp. 301]
          Length = 221

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 106/186 (56%), Gaps = 25/186 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +RII LG PG+GKGTQA  + Q  N+PQ+STGDMLRA V   T LG + K  M+SG L+ 
Sbjct: 5   LRIILLGAPGAGKGTQATFIKQHFNIPQISTGDMLRAAVKAGTPLGLEAKSFMDSGGLVP 64

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA++  +V +RI+  DC +GF+ DG+PRT+ QA+++     N   AID V+E+ V D+++
Sbjct: 65  DAVIIGMVNERIKEADCANGFLFDGFPRTIPQAEAM----KNAGVAIDYVVEIDVPDSAI 120

Query: 121 FKRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+                    +V   + I  E  V R+D+  DV  KR+  Y     
Sbjct: 121 MERMTGRRSHPASGRTYHVKFNPPKVEGKDDITGEDLVQRADEAPDVVNKRLVEYHDQTE 180

Query: 160 PLSSYY 165
           PL  YY
Sbjct: 181 PLVEYY 186


>gi|72179014|ref|XP_797255.1| PREDICTED: similar to adenylate kinase 2 [Strongylocentrotus
           purpuratus]
          Length = 249

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 118/213 (55%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPG+GKG QA +L++K  V  L+TGDMLRA +   + LGK++K  ++SG L+SD +
Sbjct: 27  VLLGPPGAGKGVQAPKLAEKYCVCHLATGDMLRAVIASGSDLGKKLKVVLDSGKLVSDEL 86

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V +++ +++  P+C +GF+LDG+PRTV QA+ L   ++    A+D+V+E  ++D+ + KR
Sbjct: 87  VVEMIDNKLGAPECKNGFLLDGFPRTVVQAEKLDELLTKRKTALDSVVEFGIDDSLLVKR 146

Query: 124 IQVRVLEA--------------------IASEKSVRSDDKYDVFLK-RIENYRKTILPLS 162
           I  R++                      +  E  ++  D  +V LK R+E Y K   PL 
Sbjct: 147 ITGRLIHKPSGRSYHTEFSPPKKPMTDDVTGEPLIKRSDDNEVTLKTRLEAYHKQTAPLV 206

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G    +D     D V  SI S+    +
Sbjct: 207 DYYSKRGIHQRVDAARAPDAVFASIQSIFAKAQ 239


>gi|221640017|ref|YP_002526279.1| Adenylate kinase [Rhodobacter sphaeroides KD131]
 gi|221160798|gb|ACM01778.1| Adenylate kinase [Rhodobacter sphaeroides KD131]
          Length = 229

 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 106/214 (49%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 14  LILLGPPGAGKGTQARMLEERFGLVQLSTGDLLRAAVAAGTPAGMAAKAVMEAGGLVSDE 73

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PD   G ILDG+PRT  QA +L   +      + A I L V+D +M +
Sbjct: 74  IVLAILADRMAQPDVSRGIILDGFPRTAGQAAALDGLLERAGQRVTAAISLEVDDGAMVE 133

Query: 123 RIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+  R   A                        +E   R DD  D    R+  Y     P
Sbjct: 134 RVSGRSTCAACGEGYHDSFKQPARAGTCDKCGGTEFKRRPDDNADTVGARLAAYHAQTAP 193

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY   G L  ID M  +DE++ ++  ++  V
Sbjct: 194 LIAYYDGCGVLERIDAMGAIDEIASALGRIVGRV 227


>gi|291548000|emb|CBL21108.1| Adenylate kinase [Ruminococcus sp. SR1/5]
          Length = 214

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MRIIMLGAPGAGKGTQAKKIAAKYGIPHISTGDIFRANIKNGTELGNKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  D   G++LDG+PRT+ QA+ L   ++ +   ID  I++ V D ++
Sbjct: 61  DELTCDLVVDRIQQDDAREGYVLDGFPRTIPQAECLTEALNKLGSKIDYAIDVDVPDDNI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                     V +    +  +R DDK +   KR+  Y +   
Sbjct: 121 VKRMGGRRACVKCGATYHVVFAAPKTEGVCDTCGDKLVLRDDDKPETVQKRLNVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG  D++EV + I  +L
Sbjct: 181 PLIDYYTTQGVLKTVDGTRDLNEVFQEIVDIL 212


>gi|253995956|ref|YP_003048020.1| adenylate kinase [Methylotenera mobilis JLW8]
 gi|253982635|gb|ACT47493.1| adenylate kinase [Methylotenera mobilis JLW8]
          Length = 217

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 116/220 (52%), Gaps = 33/220 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L +K N+PQ+STGDMLRA V   T LG + K  M+SG L+ 
Sbjct: 1   MRIILLGAPGAGKGTQATHLREKFNIPQISTGDMLRAAVKAGTPLGLEAKAFMDSGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA++  +V +RI+  DC +GF+ DG+PRT+ QA+++     +    ID V+E+ V D ++
Sbjct: 61  DAVIIGLVSERIKEADCANGFLFDGFPRTIPQAEAM----KSAGVGIDYVVEIDVPDEAI 116

Query: 121 FKRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+                    +V   + +  E  V R DD  +    R++ Y     
Sbjct: 117 IERMSGRRSHPASGRTYHVKFNPPKVEGKDDVTGEDLVQRPDDVAETVKTRLDVYHNQTK 176

Query: 160 PLSSYYRDMGC--------LYIIDGMLDMDEVSRSIDSLL 191
           PL  YY D              ++G+ DM+ +  +I + L
Sbjct: 177 PLVKYYSDWASSGTAGAPKHVFVNGLGDMNVIKENIFAAL 216


>gi|324513251|gb|ADY45450.1| Adenylate kinase 2 [Ascaris suum]
          Length = 272

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPGSGKGTQA  L+++     L+TGD+LRAEV   + LGK +K +M+SG L+S
Sbjct: 56  IRAVLLGPPGSGKGTQAPLLAKEFCACHLATGDLLRAEVASGSELGKNLKAAMDSGKLVS 115

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  V +++   +  P+C +GFILDG+PRT  QA+ L   +      +D+V+E  ++D  +
Sbjct: 116 DDTVCELINTNLNKPECQNGFILDGFPRTTVQAEKLDVVLEKRKTPLDSVVEFGIDDDLL 175

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R+                       I  E  + RSDD  +   KR+  Y +   
Sbjct: 176 VRRITGRLFHRESGRSYHIEFNPPKVPMRDDITGEPLIRRSDDNEETLRKRLVVYHQQTA 235

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G    +D  L MD+V+  I
Sbjct: 236 PLIDYYAKRGIHTKVDASLPMDDVAERI 263


>gi|83644643|ref|YP_433078.1| adenylate kinase [Hahella chejuensis KCTC 2396]
 gi|123534033|sp|Q2SL21|KAD_HAHCH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|83632686|gb|ABC28653.1| Adenylate kinase and related kinase [Hahella chejuensis KCTC 2396]
          Length = 218

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 115/212 (54%), Gaps = 33/212 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG +VK  M +G L+S
Sbjct: 1   MRIILLGAPGAGKGTQAQNIMKKFGIPQISTGDMLRAAVKAGSPLGLKVKEVMATGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  +  +V DRI+  DC +GF+ DG+PRT+ QA++L          ID V+E+ V+D  +
Sbjct: 61  DETIIALVKDRIKEDDCANGFLFDGFPRTIPQAEALR----EAGVKIDHVVEIAVDDQEI 116

Query: 121 FKRIQV-RVLEA-------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+   RV EA                   +  E  V R DDK +   KR+E Y     
Sbjct: 117 IKRLSGRRVHEASGRVYHVDYNPPKVEGKDDVTGEPLVQREDDKEETVRKRLEVYHSQTA 176

Query: 160 PLSSYYR-------DMGCLYI-IDGMLDMDEV 183
           PL  YYR       D    Y+ ++G+  +DE+
Sbjct: 177 PLVDYYRSWAEKDADAAPEYLRVEGVGSVDEI 208


>gi|74207742|dbj|BAE40113.1| unnamed protein product [Mus musculus]
          Length = 232

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEVLDDLMEKRKEKLDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHRKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDIVFASI 223


>gi|126462992|ref|YP_001044106.1| adenylate kinases [Rhodobacter sphaeroides ATCC 17029]
 gi|126104656|gb|ABN77334.1| Adenylate kinase [Rhodobacter sphaeroides ATCC 17029]
          Length = 229

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 106/214 (49%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 14  LILLGPPGAGKGTQARMLEERFGLVQLSTGDLLRAAVAAGTPAGMAAKAVMEAGGLVSDE 73

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PD   G ILDG+PRT  QA +L   +      + A I L V+D +M +
Sbjct: 74  IVLAILADRMAQPDVARGIILDGFPRTAGQAAALDGLLERAGQRVTAAISLEVDDGAMVE 133

Query: 123 RIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+  R   A                        +E   R DD  D    R+  Y     P
Sbjct: 134 RVSGRSTCAACGEGYHDSFKQPARAGTCDKCGGTEFKRRPDDNADTVGARLAAYHAQTAP 193

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY   G L  ID M  +DE++ ++  ++  V
Sbjct: 194 LIAYYDGCGVLERIDAMGAIDEIASALGRIVGRV 227


>gi|89053104|ref|YP_508555.1| adenylate kinase [Jannaschia sp. CCS1]
 gi|122499559|sp|Q28UT2|KAD_JANSC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|88862653|gb|ABD53530.1| Adenylate kinase [Jannaschia sp. CCS1]
          Length = 191

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 2/191 (1%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L +   + QLSTGDMLRA     T +G  V G M+ G L++
Sbjct: 1   MNIILLGPPGAGKGTQAGILVKDRGMVQLSTGDMLRAARTSGTEMGNLVAGVMDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++  R +L    SGFI DG+PRT+ QA +L   ++ +   +D VI + V D ++
Sbjct: 61  DEIVIGLI--REQLEAGGSGFIFDGFPRTLAQADALADLLAEVGQTLDHVIAMEVNDEAL 118

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             RI  R  EA A+ + VR+DD  +    R+  Y K   PL  YY     L  + G+  +
Sbjct: 119 VGRIVNRAKEAAAAGQPVRADDNEESLKIRLMEYYKKTSPLLGYYHAKEQLRWVPGLGAI 178

Query: 181 DEVSRSIDSLL 191
           D+V++ I  +L
Sbjct: 179 DDVAKGIADVL 189


>gi|47093977|ref|ZP_00231711.1| adenylate kinase [Listeria monocytogenes str. 4b H7858]
 gi|258611985|ref|ZP_05243531.2| adenylate kinase [Listeria monocytogenes FSL R2-503]
 gi|293596272|ref|ZP_05230029.2| adenylate kinase [Listeria monocytogenes FSL J1-194]
 gi|293596816|ref|ZP_05264478.2| adenylate kinase [Listeria monocytogenes HPB2262]
 gi|300763638|ref|ZP_07073636.1| adenylate kinase [Listeria monocytogenes FSL N1-017]
 gi|47017638|gb|EAL08437.1| adenylate kinase [Listeria monocytogenes str. 4b H7858]
 gi|258607575|gb|EEW20183.1| adenylate kinase [Listeria monocytogenes FSL R2-503]
 gi|293582666|gb|EFF94698.1| adenylate kinase [Listeria monocytogenes HPB2262]
 gi|293594269|gb|EFG02030.1| adenylate kinase [Listeria monocytogenes FSL J1-194]
 gi|300515915|gb|EFK42964.1| adenylate kinase [Listeria monocytogenes FSL N1-017]
          Length = 210

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 115/209 (55%), Gaps = 21/209 (10%)

Query: 6   LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVN 65
           +G PG+GKGTQA ++ +K N+P +STGDM RA +  NT LGK+ K  M++G L+ D + N
Sbjct: 1   MGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTELGKKAKSFMDNGDLVPDEVTN 60

Query: 66  QVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ 125
            +V +R+   D  +GF+LDG+PRTV+QA+ L   ++++   +DAVI + V+   + KR+ 
Sbjct: 61  GIVRERLAEDDAKNGFLLDGFPRTVEQAEELENILNDLGTELDAVINIEVDKDVLMKRLT 120

Query: 126 VRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSY 164
            R +                     +    E   R DDK +   KR+    K   PL  +
Sbjct: 121 GRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDDKKETVEKRLNVNMKQTKPLLDF 180

Query: 165 YRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           Y + G L+ I+G  D+ +V   ++ +L S
Sbjct: 181 YSEKGKLHNINGEQDIKDVFVDVEKILAS 209


>gi|167855593|ref|ZP_02478353.1| adenylate kinase [Haemophilus parasuis 29755]
 gi|167853284|gb|EDS24538.1| adenylate kinase [Haemophilus parasuis 29755]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 115/213 (53%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  + +K  +PQ+STGDM RA +   T LGKQ+K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQALFMMKKFGIPQISTGDMFRAAIKEGTELGKQIKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D +   +V DRI  PDC +GF+LDG+PRT+ QA +L        F+   D A + ++E  
Sbjct: 61  DELTVALVKDRISQPDCANGFLLDGFPRTIPQADALKEAGVKIDFVLEFDVADEVIVERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEK-SVRSDDKYDVFLKRIENYRKTILPLSS 163
              RV   S      ++   +V   + I  E   +R DDK +  L+R+  Y K   PL +
Sbjct: 121 SGRRVHQPSGRTYHVVYNPPKVEGKDDITGEDLIIRQDDKPETVLERLTIYHKQTKPLIA 180

Query: 164 YYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           YY           Y +DG   ++ +S  ++ +L
Sbjct: 181 YYTTEAEAGNTQYYRLDGTQSVESISDELNKIL 213


>gi|50120119|ref|YP_049286.1| adenylate kinase [Pectobacterium atrosepticum SCRI1043]
 gi|68568768|sp|Q6D7Z5|KAD_ERWCT RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|49610645|emb|CAG74090.1| adenylate kinase [Pectobacterium atrosepticum SCRI1043]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  +  K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMGKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KDAGIDVDYVIEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        + SVR DD+ D   KR+  Y +   
Sbjct: 117 IDRIIGRRVHAASGRVYHVKFNPPKVEDKDDVTGEDLSVRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+   D G    + ++G   ++EV   ++++L
Sbjct: 177 PLVSYYQKEADAGNTRYFKVEGTRKVEEVRAELETIL 213


>gi|134103240|ref|YP_001108901.1| adenylate kinase [Saccharopolyspora erythraea NRRL 2338]
 gi|133915863|emb|CAM05976.1| adenylate kinase [Saccharopolyspora erythraea NRRL 2338]
          Length = 184

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 100/167 (59%), Gaps = 10/167 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ +GPPG+GKGTQA  LS++L+VP +S+GD+ R  +  NT LG++ K  +++G L+ 
Sbjct: 2   VRLVLVGPPGAGKGTQAAVLSEQLSVPHISSGDLFRYHIGNNTPLGEEAKRYLDAGELVP 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N++V +R+  PD   GF+LDG+PR   QA  L   ++     + AV+E  V +  +
Sbjct: 62  DEITNEMVLERLAEPDAAEGFLLDGFPRNTAQADVLARSLAEKGTELTAVLEFDVPEEEL 121

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
            KR+  R           R+DD  DV  +R++ Y     PL +YYRD
Sbjct: 122 VKRLLGR----------GRADDTEDVIRRRLQVYGSETAPLLNYYRD 158


>gi|298674778|ref|YP_003726528.1| adenylate kinase [Methanohalobium evestigatum Z-7303]
 gi|298287766|gb|ADI73732.1| adenylate kinase [Methanohalobium evestigatum Z-7303]
          Length = 215

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  GPPG+GKGTQA  LS+   +P +STGD+LR  V   T LG + K  M+ G L+ 
Sbjct: 1   MNIVLFGPPGAGKGTQAKELSEFYTIPHISTGDILRENVKNETELGSKAKEYMDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +R+  PDC++G+ILDGYPRTV+QA +L   ++ ++  ++ V+ + V +  +
Sbjct: 61  DEVLIGIIKNRLVEPDCENGYILDGYPRTVNQADALEDILNKLEKPLEVVLNIEVPEEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    +   R DDK +V  +R++ Y     
Sbjct: 121 ITRLSGRRICSNCGANYHLKFSPPEKDGICDVCGGKLYQRDDDKEEVIKQRLDTYNNQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+    L  IDG  ++++V   I  +L
Sbjct: 181 PLIDYYKRKDILVNIDGTGNVEDVFEEIRGVL 212


>gi|296113451|ref|YP_003627389.1| adenylate kinase [Moraxella catarrhalis RH4]
 gi|295921145|gb|ADG61496.1| adenylate kinase [Moraxella catarrhalis RH4]
          Length = 219

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 120/221 (54%), Gaps = 32/221 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++  +PQ+STGDMLRA +   T LGKQ K  M++G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQLISKEFGIPQISTGDMLRAAIKAGTELGKQAKSVMDAGQLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PDCD+G I DG+PRT+ QAK+L    ++   AID VIE+   D  +
Sbjct: 62  DELIINLVKERLKQPDCDNGCIFDGFPRTIPQAKAL----ADAGIAIDYVIEISAPDDEI 117

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     ++ +  E  V R DDK +V   R+  Y     
Sbjct: 118 VSRMSGRRAHLASGRTYHVIYNPPKTDGIDDVTGEALVQRDDDKEEVVRDRLSVYHAQTT 177

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLLVS 193
            L ++Y+++          +  DG   +D V   I ++L S
Sbjct: 178 TLINHYQEVAKSGENAPEYHDFDGTKSIDTVRDEIFAVLKS 218


>gi|251799621|ref|YP_003014352.1| adenylate kinase [Paenibacillus sp. JDR-2]
 gi|247547247|gb|ACT04266.1| adenylate kinase [Paenibacillus sp. JDR-2]
          Length = 216

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+F+GPPG+GKGTQA R+  +  +P +STGD  R  + + T LG + K  ++ G L+S
Sbjct: 1   MNILFMGPPGAGKGTQAERIVGEFGIPHISTGDAFRLAMKQGTPLGLKAKEYVDQGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V +R+   DC+ GF+LDG+PRT+ QA++L   ++ ++ +ID V+ L+V+   +
Sbjct: 61  DEITNGIVKERLAQDDCNKGFLLDGFPRTLQQAEALDVMLTELNRSIDHVVNLKVDRGLL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    E   RSDD  +    R++ Y     
Sbjct: 121 LARLTGRRICKACGSTYHVMFNPPKQEGVCDKCGGELYQRSDDTEEKVGTRLDEYISKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG  ++D V+  I S L
Sbjct: 181 PLLDYYNGKGLLREVDGEKEIDTVTAEIVSCL 212


>gi|53803913|ref|YP_114497.1| adenylate kinase [Methylococcus capsulatus str. Bath]
 gi|68568755|sp|Q606F1|KAD_METCA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|53757674|gb|AAU91965.1| adenylate kinase [Methylococcus capsulatus str. Bath]
          Length = 214

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 108/188 (57%), Gaps = 27/188 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LG PGSGKGTQA  L+++  +PQ+STGDMLRA V   T LG + K  M++G L+S
Sbjct: 1   MRIMLLGSPGSGKGTQAKYLTERFGIPQISTGDMLRAAVREGTPLGMEAKKIMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+I+  ++ +RI  PDC +GF+LDG+PRT+ QA +L    + +   +D V+E+ V+D  +
Sbjct: 61  DSIILGLIKERIAAPDCANGFLLDGFPRTIVQADAL----AELGVTLDHVVEIAVDDEEI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS ++                       R DDK +   +R+E Y    
Sbjct: 117 VRRLSGRRVHP-ASGRTYHVVFNPPKVEGRDDETGEPLVQREDDKEETIRRRLEIYHVQT 175

Query: 159 LPLSSYYR 166
            PL  YYR
Sbjct: 176 KPLVDYYR 183


>gi|116671501|ref|YP_832434.1| adenylate kinase [Arthrobacter sp. FB24]
 gi|116611610|gb|ABK04334.1| Adenylate kinase [Arthrobacter sp. FB24]
          Length = 192

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 111/183 (60%), Gaps = 6/183 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPGSGKGTQA R+S++L V  +STGD+ RA V   T LG + K  M++G  + D
Sbjct: 3   RMLIIGPPGSGKGTQADRISERLGVVAISTGDIFRANVKGETPLGVEAKKYMDAGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N++V DR+   D ++GF+LDGYPRT  Q   L   ++N +  +D V++L  +D  + 
Sbjct: 63  SVTNKMVRDRLSEDDVENGFLLDGYPRTTAQVDYLDEILANGEQKLDVVLQLTADDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      ++++ RSDD   V   R++ Y +    + + Y + G L  +DG+  +D
Sbjct: 123 HRLLGR------AKETGRSDDNEAVIRHRLDLYHEQTEAVVAKYAERGILTQVDGIGGID 176

Query: 182 EVS 184
           EV+
Sbjct: 177 EVT 179


>gi|149694095|ref|XP_001503800.1| PREDICTED: similar to Adenylate kinase isoenzyme 2, mitochondrial
           (ATP-AMP transphosphorylase) [Equus caballus]
          Length = 241

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  V D+ +
Sbjct: 78  DEMVVELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSVPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPLSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKVRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 198 PLVEYYRKRGIHSAIDASQTPDVVFASI 225


>gi|227520013|ref|ZP_03950062.1| adenylate kinase [Enterococcus faecalis TX0104]
 gi|227555874|ref|ZP_03985921.1| adenylate kinase [Enterococcus faecalis HH22]
 gi|229546943|ref|ZP_04435668.1| adenylate kinase [Enterococcus faecalis TX1322]
 gi|229550532|ref|ZP_04439257.1| adenylate kinase [Enterococcus faecalis ATCC 29200]
 gi|293382737|ref|ZP_06628662.1| adenylate kinase [Enterococcus faecalis R712]
 gi|293388080|ref|ZP_06632608.1| adenylate kinase [Enterococcus faecalis S613]
 gi|307269108|ref|ZP_07550469.1| adenylate kinase [Enterococcus faecalis TX4248]
 gi|307274192|ref|ZP_07555400.1| adenylate kinase [Enterococcus faecalis TX0855]
 gi|307276417|ref|ZP_07557540.1| adenylate kinase [Enterococcus faecalis TX2134]
 gi|307278627|ref|ZP_07559697.1| adenylate kinase [Enterococcus faecalis TX0860]
 gi|307286993|ref|ZP_07567068.1| adenylate kinase [Enterococcus faecalis TX0109]
 gi|307291666|ref|ZP_07571541.1| adenylate kinase [Enterococcus faecalis TX0411]
 gi|312901101|ref|ZP_07760389.1| adenylate kinase [Enterococcus faecalis TX0470]
 gi|312908632|ref|ZP_07767574.1| adenylate kinase [Enterococcus faecalis DAPTO 512]
 gi|312909220|ref|ZP_07768077.1| adenylate kinase [Enterococcus faecalis DAPTO 516]
 gi|312952628|ref|ZP_07771492.1| adenylate kinase [Enterococcus faecalis TX0102]
 gi|227072561|gb|EEI10524.1| adenylate kinase [Enterococcus faecalis TX0104]
 gi|227175041|gb|EEI56013.1| adenylate kinase [Enterococcus faecalis HH22]
 gi|229304251|gb|EEN70247.1| adenylate kinase [Enterococcus faecalis ATCC 29200]
 gi|229307871|gb|EEN73858.1| adenylate kinase [Enterococcus faecalis TX1322]
 gi|291079897|gb|EFE17261.1| adenylate kinase [Enterococcus faecalis R712]
 gi|291082531|gb|EFE19494.1| adenylate kinase [Enterococcus faecalis S613]
 gi|306497285|gb|EFM66827.1| adenylate kinase [Enterococcus faecalis TX0411]
 gi|306501939|gb|EFM71228.1| adenylate kinase [Enterococcus faecalis TX0109]
 gi|306504687|gb|EFM73887.1| adenylate kinase [Enterococcus faecalis TX0860]
 gi|306506897|gb|EFM76044.1| adenylate kinase [Enterococcus faecalis TX2134]
 gi|306509154|gb|EFM78216.1| adenylate kinase [Enterococcus faecalis TX0855]
 gi|306514588|gb|EFM83142.1| adenylate kinase [Enterococcus faecalis TX4248]
 gi|310625419|gb|EFQ08702.1| adenylate kinase [Enterococcus faecalis DAPTO 512]
 gi|310629416|gb|EFQ12699.1| adenylate kinase [Enterococcus faecalis TX0102]
 gi|311290462|gb|EFQ69018.1| adenylate kinase [Enterococcus faecalis DAPTO 516]
 gi|311291773|gb|EFQ70329.1| adenylate kinase [Enterococcus faecalis TX0470]
 gi|315026814|gb|EFT38746.1| adenylate kinase [Enterococcus faecalis TX2137]
 gi|315028854|gb|EFT40786.1| adenylate kinase [Enterococcus faecalis TX4000]
 gi|315031160|gb|EFT43092.1| adenylate kinase [Enterococcus faecalis TX0017]
 gi|315035994|gb|EFT47926.1| adenylate kinase [Enterococcus faecalis TX0027]
 gi|315145357|gb|EFT89373.1| adenylate kinase [Enterococcus faecalis TX2141]
 gi|315147150|gb|EFT91166.1| adenylate kinase [Enterococcus faecalis TX4244]
 gi|315151092|gb|EFT95108.1| adenylate kinase [Enterococcus faecalis TX0012]
 gi|315153588|gb|EFT97604.1| adenylate kinase [Enterococcus faecalis TX0031]
 gi|315156232|gb|EFU00249.1| adenylate kinase [Enterococcus faecalis TX0043]
 gi|315158623|gb|EFU02640.1| adenylate kinase [Enterococcus faecalis TX0312]
 gi|315160749|gb|EFU04766.1| adenylate kinase [Enterococcus faecalis TX0645]
 gi|315165880|gb|EFU09897.1| adenylate kinase [Enterococcus faecalis TX1302]
 gi|315168121|gb|EFU12138.1| adenylate kinase [Enterococcus faecalis TX1341]
 gi|315171439|gb|EFU15456.1| adenylate kinase [Enterococcus faecalis TX1342]
 gi|315172673|gb|EFU16690.1| adenylate kinase [Enterococcus faecalis TX1346]
 gi|315573535|gb|EFU85726.1| adenylate kinase [Enterococcus faecalis TX0309B]
 gi|315579347|gb|EFU91538.1| adenylate kinase [Enterococcus faecalis TX0630]
 gi|315582117|gb|EFU94308.1| adenylate kinase [Enterococcus faecalis TX0309A]
 gi|327534025|gb|AEA92859.1| adenylate kinase [Enterococcus faecalis OG1RF]
          Length = 231

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  ++ G L+ 
Sbjct: 16  MNLILMGLPGAGKGTQAEKIIDTYGIPHISTGDMFRAAMKNETALGLEAKSYIDKGELVP 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD D GF+LDG+PRT+DQAK+L   +  ++  IDAVI++ VE+  +
Sbjct: 76  DEVTNGIVKERLAEPDTDKGFLLDGFPRTLDQAKALDTMLKELNKKIDAVIDIHVEEDVL 135

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            +R+  R +                           E   R DDK +    R+    ++ 
Sbjct: 136 IERLAGRFICRTCGATYHKLFNPPKVEGTCDRCGGHEFYQREDDKPETVKNRLAVNIESS 195

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ ++Y++ G ++ IDG       +R ID++   V+K
Sbjct: 196 APILAFYKEQGLMHTIDG-------NREIDTVFSDVKK 226


>gi|315640140|ref|ZP_07895262.1| adenylate kinase [Enterococcus italicus DSM 15952]
 gi|315484117|gb|EFU74591.1| adenylate kinase [Enterococcus italicus DSM 15952]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 118/218 (54%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++ +G PG+GKGTQA R+    N+P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNLVLMGLPGAGKGTQAERIVATYNIPHISTGDMFRAAMANKTELGLKAKSYMDQGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+   D D GF+LDG+PRT+DQAK+L   ++ +   +DAVI++ V ++ +
Sbjct: 61  DEVTNGIVKERLAESDTDKGFLLDGFPRTLDQAKALDTMLNELGKKLDAVIDIHVPESIL 120

Query: 121 FKRIQVRVL--EAIASEKSV--------------------RSDDKYDVFLKRIENYRKTI 158
             R+  R +  +  A+   V                    R DDK +    R+    K+ 
Sbjct: 121 VGRLTGRFMCRDCGATYHKVFNPTKVEGTCDKCGGHNFYQREDDKPETVKNRLAVNVKSS 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ SYY+D G L  IDG       +R ID++   V+K
Sbjct: 181 EPILSYYKDKGLLQSIDG-------NREIDAVFADVKK 211


>gi|148273781|ref|YP_001223342.1| adenylate kinase [Clavibacter michiganensis subsp. michiganensis
           NCPPB 382]
 gi|259493991|sp|A5CU93|KAD_CLAM3 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|147831711|emb|CAN02680.1| putative adenylate kinase [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 200

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 6/199 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA R++ +  +P +STGD+ R  +   T LG+QV+  +++G+ + D
Sbjct: 3   RLLIVGPPGAGKGTQAKRIASEYGIPDVSTGDIFRQNIKDRTELGQQVQALVDAGNYVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + N++V  R++  D  +GF+LDGYPRT+ Q   L   +      +DAVI+L  ++  + 
Sbjct: 63  ELTNRLVTARLQEEDARAGFLLDGYPRTLAQVAYLEELLQGWGQELDAVIQLVADEDEVV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R     A+E+  R+DD  +    R E Y +   PL   YR+ G L  +DG+ ++D
Sbjct: 123 ARLTRR-----AAEQG-RADDGEEEIRHRQEVYVRETSPLIDVYRERGLLLEVDGLGEVD 176

Query: 182 EVSRSIDSLLVSVRKKCSS 200
           EV+  I + L     + SS
Sbjct: 177 EVAERIRAALAGRGVRPSS 195


>gi|294495993|ref|YP_003542486.1| adenylate kinase [Methanohalophilus mahii DSM 5219]
 gi|292666992|gb|ADE36841.1| Adenylate kinase [Methanohalophilus mahii DSM 5219]
          Length = 216

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++  GPPG+GKGTQA  LS   ++P +STGD+LRA V + T LGK+ +  M  G L+ 
Sbjct: 1   MNVVLFGPPGAGKGTQAKELSSYYDIPHISTGDILRANVKQGTELGKKAEHYMNRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++ +R+  PDC  G++LDGYPRT+ QA++L   +  +   +D V+ + V D  +
Sbjct: 61  DEVLIGIIKNRLAEPDCKKGYLLDGYPRTIPQAEALDGILEEIGMPLDVVLNIDVPDEEL 120

Query: 121 FKRIQVR--------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
             R+  R                    V ++   +   R DD+ +V  +R+E+Y+    P
Sbjct: 121 VGRLSGRYMCECGESYHVRFNPPQNEGVCDSCGGQLYQREDDREEVIRQRLESYKNKTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY +   +  I+G  D++ V   I  +L
Sbjct: 181 LIDYYANKNLVVHINGEKDINSVFDDIRVVL 211


>gi|160894734|ref|ZP_02075509.1| hypothetical protein CLOL250_02285 [Clostridium sp. L2-50]
 gi|156863668|gb|EDO57099.1| hypothetical protein CLOL250_02285 [Clostridium sp. L2-50]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +++K  VP +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 30  MKIIMLGAPGAGKGTQAKMIAEKYGVPHISTGDIFRANIKNGTELGAKAKEYMDKGLLVP 89

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR +  DC  G+ILDG+PRT+ QA++L   +S +  ++D  I + V D ++
Sbjct: 90  DELVVDLVIDRFKADDCAKGYILDGFPRTIPQAEALDKALSAIGDSVDYAINVEVPDENI 149

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +  +S+  +R DD+ +  L R++ Y +   
Sbjct: 150 VRRMSGRRACVGCGATYHIVYNPTKVEGKCDVCSSDLILRDDDQPETVLNRLKVYHEQTQ 209

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y   G L  +DG +DM++V  +I  +L
Sbjct: 210 PLIDFYAKKGILKEVDGTMDMNDVFAAIVKIL 241


>gi|126734512|ref|ZP_01750258.1| adenylate kinase [Roseobacter sp. CCS2]
 gi|126715067|gb|EBA11932.1| adenylate kinase [Roseobacter sp. CCS2]
          Length = 228

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 112/216 (51%), Gaps = 22/216 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L  +  + QLSTGD+LRA V   +  GK  K  ME+G L+SD 
Sbjct: 13  LILLGPPGAGKGTQARMLEDRFGLVQLSTGDLLRAAVASGSKAGKAAKAVMEAGDLVSDD 72

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PDC +G ILDG+PRT  QA++L   +++    IDA + L V+D  M  
Sbjct: 73  IVIAILRDRLAQPDCANGVILDGFPRTTAQAEALDHMLADSGQQIDAAVLLEVDDVKMVV 132

Query: 123 RIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                           A   + R+DD     + R++ Y +   P
Sbjct: 133 RIAGRFTCGDCGEGYHDTFKTPKVADTCDNCGARNMTRRADDNASTVMARLDAYHEQTAP 192

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           L +YY   G L  +D M ++  +  +I +L  SV +
Sbjct: 193 LIAYYDGKGVLRRVDAMGEIGGIQSAIATLTESVMR 228


>gi|210611146|ref|ZP_03288760.1| hypothetical protein CLONEX_00950 [Clostridium nexile DSM 1787]
 gi|210152133|gb|EEA83140.1| hypothetical protein CLONEX_00950 [Clostridium nexile DSM 1787]
          Length = 225

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 124/212 (58%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 12  MKIIMLGAPGAGKGTQAKKIAEKYSIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 71

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR++  DC +G++LDG+PRT+ QA++L   ++ M  A+D  I + V D ++
Sbjct: 72  DELVVDLVVDRVKQDDCSNGYVLDGFPRTIPQAEALDKALAAMGEAMDYAINVEVPDENI 131

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
            +R+  R           ++ A   E+++          R DDK +   KR+  Y +   
Sbjct: 132 VRRMSGRRACVDCGATYHIVYAPTKEENICDNCHGELILREDDKPETVQKRLNVYHEQTQ 191

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY +   L  +DG +D+DEV  +I ++L
Sbjct: 192 PLIDYYTEKNILVEVDGTVDIDEVFAAIVNVL 223


>gi|196014588|ref|XP_002117153.1| hypothetical protein TRIADDRAFT_50996 [Trichoplax adhaerens]
 gi|190580375|gb|EDV20459.1| hypothetical protein TRIADDRAFT_50996 [Trichoplax adhaerens]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 111/209 (53%), Gaps = 21/209 (10%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           I LGPPG+GKGTQA RL+ +  V  LSTGDMLRA V   + LG +VK  ++ G L++D+I
Sbjct: 23  ILLGPPGAGKGTQALRLASRYCVCHLSTGDMLRAVVASGSELGGRVKKIIDEGGLVNDSI 82

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V +++ + +  P C +GF+LDG+PR   QA  L   +      +D+V+E ++ED+ + +R
Sbjct: 83  VVELINENLDQPKCKNGFLLDGFPRNTKQADMLDELLDKRQQKLDSVVEFKIEDSLLVRR 142

Query: 124 IQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTILPLS 162
           I  R+L                      +  E  + RSDD     +KR+  Y    LPL 
Sbjct: 143 ITGRLLHPPSGRVYHEEFNPPKVPLKDDVTGEPLIKRSDDNETTLMKRLNTYHTVTLPLV 202

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            YY+  G    ++  +  D V  +I ++ 
Sbjct: 203 DYYKQRGVYSFVNAAMSPDTVFTTIRNIF 231


>gi|322381107|ref|ZP_08055110.1| adenylate kinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154683|gb|EFX46954.1| adenylate kinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 238

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 108/212 (50%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + IIF+GPPG+GKGTQA ++     +P +STGD  R  + + T LG + KG ++ G L+ 
Sbjct: 22  LNIIFMGPPGAGKGTQAEKIVSDFQIPHISTGDAFRLAMSQGTPLGIKAKGYVDKGLLVP 81

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V +R+  PDC  GF+LDGYPRT+ QA +L   + +    ID V+ L V+   +
Sbjct: 82  DEITNGIVKERLEQPDCAKGFLLDGYPRTIAQADALDEMLKSQSRQIDHVMNLTVDRELL 141

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E   RSDD  +    R++ Y     
Sbjct: 142 LARLTGRRICKSCGATYHVLFNPPKHEGICDKCGGELYQRSDDTEEKVGTRLDEYTNKTA 201

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR  G L  ++G  D+  V+  I S+L
Sbjct: 202 PLLDYYRQKGILREVNGEQDITAVTSEISSIL 233


>gi|227115288|ref|ZP_03828944.1| adenylate kinase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAM----KDAGINVDYVIEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        + ++R DD+ D   KR+  Y +   
Sbjct: 117 IDRIIGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+   + G    + ++G   ++EV   ++++L
Sbjct: 177 PLVSYYQKEAEAGNTRYFKVEGTRKVEEVRAELETIL 213


>gi|77464149|ref|YP_353653.1| adenylate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|77388567|gb|ABA79752.1| Adenylate kinase [Rhodobacter sphaeroides 2.4.1]
          Length = 217

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 106/214 (49%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L ++  + QLSTGD+LRA V   T  G   K  ME+G L+SD 
Sbjct: 2   LILLGPPGAGKGTQARMLEERFGLVQLSTGDLLRAAVAAGTPAGMAAKAVMEAGGLVSDE 61

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+  PD   G ILDG+PRT  QA +L   +      + A I L V+D +M +
Sbjct: 62  IVLAILADRMAQPDVARGIILDGFPRTAGQAAALDGLLERAGQRVTAAISLEVDDGAMVE 121

Query: 123 RIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           R+  R   A                        +E   R DD  D    R+  Y     P
Sbjct: 122 RVSGRSTCAACGEGYHDSFKQPARAGTCDKCGGTEFKRRPDDNADTVGARLAAYHAQTAP 181

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY   G L  ID M  +DE++ ++  ++  V
Sbjct: 182 LIAYYDGCGVLERIDAMGAIDEIASALGRIVGRV 215


>gi|29374872|ref|NP_814025.1| adenylate kinase [Enterococcus faecalis V583]
 gi|255971730|ref|ZP_05422316.1| adenylate kinase [Enterococcus faecalis T1]
 gi|255974730|ref|ZP_05425316.1| adenylate kinase [Enterococcus faecalis T2]
 gi|256618359|ref|ZP_05475205.1| adenylate kinase [Enterococcus faecalis ATCC 4200]
 gi|256762025|ref|ZP_05502605.1| adenylate kinase [Enterococcus faecalis T3]
 gi|256855184|ref|ZP_05560545.1| adenylate kinase [Enterococcus faecalis T8]
 gi|256956841|ref|ZP_05561012.1| adenylate kinase [Enterococcus faecalis DS5]
 gi|256960648|ref|ZP_05564819.1| adenylate kinase [Enterococcus faecalis Merz96]
 gi|256964153|ref|ZP_05568324.1| adenylate kinase [Enterococcus faecalis HIP11704]
 gi|257078511|ref|ZP_05572872.1| adenylate kinase [Enterococcus faecalis JH1]
 gi|257081518|ref|ZP_05575879.1| adenylate kinase [Enterococcus faecalis E1Sol]
 gi|257084166|ref|ZP_05578527.1| adenylate kinase [Enterococcus faecalis Fly1]
 gi|257087993|ref|ZP_05582354.1| adenylate kinase [Enterococcus faecalis D6]
 gi|257088670|ref|ZP_05583031.1| adenylate kinase [Enterococcus faecalis CH188]
 gi|257417597|ref|ZP_05594591.1| adenylate kinase [Enterococcus faecalis AR01/DG]
 gi|257418678|ref|ZP_05595672.1| adenylate kinase [Enterococcus faecalis T11]
 gi|257421521|ref|ZP_05598511.1| adenylate kinase [Enterococcus faecalis X98]
 gi|294781072|ref|ZP_06746423.1| adenylate kinase [Enterococcus faecalis PC1.1]
 gi|300861910|ref|ZP_07107990.1| adenylate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|46396107|sp|Q839E3|KAD_ENTFA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|29342330|gb|AAO80096.1| adenylate kinase [Enterococcus faecalis V583]
 gi|255962748|gb|EET95224.1| adenylate kinase [Enterococcus faecalis T1]
 gi|255967602|gb|EET98224.1| adenylate kinase [Enterococcus faecalis T2]
 gi|256597886|gb|EEU17062.1| adenylate kinase [Enterococcus faecalis ATCC 4200]
 gi|256683276|gb|EEU22971.1| adenylate kinase [Enterococcus faecalis T3]
 gi|256709697|gb|EEU24744.1| adenylate kinase [Enterococcus faecalis T8]
 gi|256947337|gb|EEU63969.1| adenylate kinase [Enterococcus faecalis DS5]
 gi|256951144|gb|EEU67776.1| adenylate kinase [Enterococcus faecalis Merz96]
 gi|256954649|gb|EEU71281.1| adenylate kinase [Enterococcus faecalis HIP11704]
 gi|256986541|gb|EEU73843.1| adenylate kinase [Enterococcus faecalis JH1]
 gi|256989548|gb|EEU76850.1| adenylate kinase [Enterococcus faecalis E1Sol]
 gi|256992196|gb|EEU79498.1| adenylate kinase [Enterococcus faecalis Fly1]
 gi|256996023|gb|EEU83325.1| adenylate kinase [Enterococcus faecalis D6]
 gi|256997482|gb|EEU84002.1| adenylate kinase [Enterococcus faecalis CH188]
 gi|257159425|gb|EEU89385.1| adenylate kinase [Enterococcus faecalis ARO1/DG]
 gi|257160506|gb|EEU90466.1| adenylate kinase [Enterococcus faecalis T11]
 gi|257163345|gb|EEU93305.1| adenylate kinase [Enterococcus faecalis X98]
 gi|294451875|gb|EFG20326.1| adenylate kinase [Enterococcus faecalis PC1.1]
 gi|295112520|emb|CBL31157.1| Adenylate kinase [Enterococcus sp. 7L76]
 gi|300848435|gb|EFK76192.1| adenylate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|323479443|gb|ADX78882.1| adenylate kinase [Enterococcus faecalis 62]
          Length = 216

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  ++ G L+ 
Sbjct: 1   MNLILMGLPGAGKGTQAEKIIDTYGIPHISTGDMFRAAMKNETALGLEAKSYIDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD D GF+LDG+PRT+DQAK+L   +  ++  IDAVI++ VE+  +
Sbjct: 61  DEVTNGIVKERLAEPDTDKGFLLDGFPRTLDQAKALDTMLKELNKKIDAVIDIHVEEDVL 120

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            +R+  R +                           E   R DDK +    R+    ++ 
Sbjct: 121 IERLAGRFICRTCGATYHKLFNPPKVEGTCDRCGGHEFYQREDDKPETVKNRLAVNIESS 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ ++Y++ G ++ IDG       +R ID++   V+K
Sbjct: 181 APILAFYKEQGLMHTIDG-------NREIDTVFSDVKK 211


>gi|225717950|gb|ACO14821.1| Adenylate kinase isoenzyme 2, mitochondrial [Caligus clemensi]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (52%), Gaps = 24/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ LGPPGSGKGTQ+ +L +  N+  LSTGD+LR EV   T LG Q+K  +++G L+S
Sbjct: 18  VRMVLLGPPGSGKGTQSPKLKEFFNICHLSTGDLLRHEVRNKTPLGHQIKSIIDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISN-MDCAIDAVIELRVEDAS 119
           D +V ++V   +   +C +GF+LDGYPRTV QA+ L   +    + ++DA +E  ++D+ 
Sbjct: 78  DDVVLKLVEKNLDSKECQNGFLLDGYPRTVSQAEQLDKLLEKRKEPSLDAAVEFAIDDSL 137

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           + +RI  R    +AS +S                       R DD  +   KR+  Y   
Sbjct: 138 LVRRISGRWFH-MASGRSYHEEFKPPKVHAVDDVTGEPLIKRKDDNAETLQKRLATYHSE 196

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            +PL  YY+       ID  LD   V  +I ++   + K
Sbjct: 197 TMPLVDYYQKRQIHRRIDAALDSSTVFSTIKTIFADLNK 235


>gi|298491417|ref|YP_003721594.1| adenylate kinase ['Nostoc azollae' 0708]
 gi|298233335|gb|ADI64471.1| adenylate kinase ['Nostoc azollae' 0708]
          Length = 184

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 108/192 (56%), Gaps = 10/192 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IFLGPPG+GKGTQA  L++ L++P +STGD+LR  +   T LG + +  M+ G L+ D
Sbjct: 3   RLIFLGPPGAGKGTQAKNLAEFLHIPHISTGDILRQAIKDQTPLGLKAQVYMDKGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V +R+  PD  +G+ILDG+PR V QA  L   ++ +    + V+ L   D ++ 
Sbjct: 63  QLVEDLVKERLNQPDAQNGWILDGFPRKVTQAAFLEELLTTIGQGGEKVVNLDAPDETVI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R           R DD  DV  +R+E YR+   PL  YY     L  ++G    +
Sbjct: 123 SRLLGR----------GRKDDSEDVIRRRLEVYREETAPLIDYYGARHKLLTVNGNQSPE 172

Query: 182 EVSRSIDSLLVS 193
           EV+  + +L+ +
Sbjct: 173 EVTTELQNLIAA 184


>gi|116072181|ref|ZP_01469449.1| Adenylate kinase, subfamily protein [Synechococcus sp. BL107]
 gi|116065804|gb|EAU71562.1| Adenylate kinase, subfamily protein [Synechococcus sp. BL107]
          Length = 183

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 112/190 (58%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA R+     +  LSTGD+LR+EV   + LGK+ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARICDSNGMKHLSTGDLLRSEVAAGSELGKEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V  +++    + G++LDG+PRTV QA++L   +S +   I+AV+ L ++DA + 
Sbjct: 64  QLVLAIVESQMKALSGE-GWLLDGFPRTVPQAEALEPLLSELKQPIEAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R           R+DD  DV   R+E YR    PL +YY++ G L  +     ++
Sbjct: 123 TRMLSR----------GRADDNEDVIRNRLEVYRDKTAPLINYYQNKGLLISVPAEGSVE 172

Query: 182 EVSRSIDSLL 191
           E++  I  +L
Sbjct: 173 EITERISKVL 182


>gi|149915087|ref|ZP_01903615.1| adenylate kinase [Roseobacter sp. AzwK-3b]
 gi|149810808|gb|EDM70647.1| adenylate kinase [Roseobacter sp. AzwK-3b]
          Length = 228

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 112/211 (53%), Gaps = 22/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L +K  + QLSTGD+LR+ V   T  GK  K  ME+G L+SD 
Sbjct: 13  LILLGPPGAGKGTQARLLEEKHGLVQLSTGDLLRSAVAAGTEAGKAAKAVMEAGDLVSDE 72

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DR+   DC  G ILDG+PRT  QA++L   +      I+A I L V+DASM  
Sbjct: 73  IVIAILRDRLAEADCARGVILDGFPRTTVQAEALDTLLVETGQKINAAISLEVDDASMVT 132

Query: 123 RIQVR---------------------VLEAI-ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                     + +A   ++   R+DD      +R+  Y     P
Sbjct: 133 RISGRFTCGGCGEGYHDSFKPTDKPGICDACGGTDMKRRADDNAATVAQRLAAYHAQTAP 192

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  +Y+  G L  I  M  +DE++ ++DS++
Sbjct: 193 LIDHYQGKGALSRIPAMGAIDEIAAALDSVV 223


>gi|242238470|ref|YP_002986651.1| adenylate kinase [Dickeya dadantii Ech703]
 gi|242130527|gb|ACS84829.1| adenylate kinase [Dickeya dadantii Ech703]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 115/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++         ++D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KEAGISVDNVIEFDVPDELI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +A   + SVR DD+ D   KR+  Y +   
Sbjct: 117 VERIIGRRVHAASGRVYHVKFNPPKVEGKDDATGEDLSVRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + IDG   + +VS  +  +L
Sbjct: 177 PLVDYYQQEAAAGNTRYHKIDGTRAVSDVSAELARIL 213


>gi|225717476|gb|ACO14584.1| Adenylate kinase isoenzyme 2, mitochondrial [Caligus clemensi]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (52%), Gaps = 24/219 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ LGPPGSGKGTQ+ +L +  N+  LSTGD+LR EV   T LG Q+K  +++G L+S
Sbjct: 18  VRMVLLGPPGSGKGTQSPKLKEFFNICHLSTGDLLRHEVRNKTPLGHQIKSIIDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISN-MDCAIDAVIELRVEDAS 119
           D +V ++V   +   +C +GF+LDGYPRTV QA+ L   +    + ++DA +E  ++D+ 
Sbjct: 78  DDVVLKLVEKNLDSKECQNGFLLDGYPRTVSQAEQLDKLLEKRKEPSLDAAVEFAIDDSL 137

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           + +RI  R    +AS +S                       R DD  +   KR+  Y   
Sbjct: 138 LVRRISRRWFH-MASGRSYHEEFKPPKVHAVDDVTGEPLIKRKDDNAETLQKRLATYHSE 196

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            +PL  YY+       ID  LD   V  +I ++   + K
Sbjct: 197 TMPLVDYYQKRQIHRRIDAALDSSTVFSTIKTIFADLNK 235


>gi|85374443|ref|YP_458505.1| adenylate kinase [Erythrobacter litoralis HTCC2594]
 gi|122544186|sp|Q2N9D3|KAD_ERYLH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|84787526|gb|ABC63708.1| adenylate kinase [Erythrobacter litoralis HTCC2594]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 114/213 (53%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQ+ RL ++  + QLSTGDMLRA V   T +G + K  M+ G L+S
Sbjct: 1   MNIILLGPPGAGKGTQSQRLVERHGMRQLSTGDMLRAAVKAQTPVGLKAKAVMDRGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV++++   +     + G I DGYPRT  QA  L   ++  D ++D VIEL V + ++
Sbjct: 61  DDIVSELIDAELTAMHGNVGAIFDGYPRTAAQAGQLDVILAKHDRSLDKVIELEVNEEAL 120

Query: 121 FKRIQVRVL-----------------EAI-----ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                   E +     ++E   R DD  +    R++ YR   
Sbjct: 121 VDRITGRFTCAKCGTGYHDRHKQPAREGVCDVCGSTEFKRRPDDNEETVRTRMQEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+   Y + G +  +DGM  +DEV+ +ID+LL
Sbjct: 181 APILPIYEERGLVERVDGMGGIDEVTAAIDALL 213


>gi|297621476|ref|YP_003709613.1| adenylate kinase [Waddlia chondrophila WSU 86-1044]
 gi|297376777|gb|ADI38607.1| adenylate kinase [Waddlia chondrophila WSU 86-1044]
          Length = 221

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 109/195 (55%), Gaps = 23/195 (11%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPGSGKGTQA R++Q+LN+P +STGD+LR  +   T LG++ K  M +G L+ DA
Sbjct: 12  VILLGPPGSGKGTQAKRVTQELNIPHISTGDILRENIKSETELGRRAKEFMNAGRLVPDA 71

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           +V  ++ +R+   DC  G++LDG+PRT+ QA+SL  F+ +    +   I L V D  + K
Sbjct: 72  LVLDMLFERVLRKDCKPGYLLDGFPRTIPQAESLDQFLESKVHLV--AINLAVSDEIIVK 129

Query: 123 RIQVRV-----------------LEAI----ASEKSVRSDDKYDVFLKRIENYRKTILPL 161
           RI  R+                 LE I      E   R DD+ +V  +R+  Y K   PL
Sbjct: 130 RISGRLSCTVCGHVRNRFLSPPKLEGICDLCGGELIQRPDDRSEVVKERLLVYAKQTAPL 189

Query: 162 SSYYRDMGCLYIIDG 176
             YY   G L+ IDG
Sbjct: 190 IDYYERKGILHTIDG 204


>gi|266620242|ref|ZP_06113177.1| adenylate kinase [Clostridium hathewayi DSM 13479]
 gi|288868145|gb|EFD00444.1| adenylate kinase [Clostridium hathewayi DSM 13479]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K  +P +STGD+ R+ +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAEKYQIPHISTGDIFRSNIKEGTELGMKAKAYMDQGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   ++ DRI+  DC +G++LDG+PRT+ QA+SL   ++  +  ID  + + V D ++
Sbjct: 61  DELTIGMLMDRIQKDDCKNGYVLDGFPRTIPQAESLTNALNERNQKIDYAVNVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    +  +R DDK +   KR+  Y     
Sbjct: 121 VNRMSGRRACLSCGATYHIVYKPSKVEGICDVCGDKLVLRDDDKPETVKKRLSVYHDQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++ G L  +DG  DM++V   I ++L
Sbjct: 181 PLIDYYKEAGVLANVDGTQDMEKVFSDIVAVL 212


>gi|326388218|ref|ZP_08209821.1| adenylate kinase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207384|gb|EGD58198.1| adenylate kinase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 115/214 (53%), Gaps = 22/214 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQ+ RL ++  + QLSTGDMLRA V   T +G + K  M++G L+S
Sbjct: 1   MNIILLGPPGAGKGTQSQRLVERHGLKQLSTGDMLRAAVKAGTPVGLKAKAVMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV+ ++ D + +     G I DGYPRT  QA+SL   +++    +D VIEL V++ ++
Sbjct: 61  DEIVSALIGDELDVMGPGQGAIFDGYPRTAAQAESLDGILASRGRKLDHVIELDVDEDAL 120

Query: 121 FKRIQVR------------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTI 158
            +RI  R              E  A E +           R DD  +    R+  YR   
Sbjct: 121 VERITGRYTCATCGKGYHDTFEKPAVEGTCDKCGGHEFKRRPDDNEETVRTRMAEYRAKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLV 192
            P+   Y   G +  +DGM  MD+V+ +I++++ 
Sbjct: 181 APILPIYEARGIVAHVDGMAQMDDVTAAIEAVIA 214


>gi|116199685|ref|XP_001225654.1| adenylate kinase [Chaetomium globosum CBS 148.51]
 gi|121780402|sp|Q2GVK6|KAD1_CHAGB RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|88179277|gb|EAQ86745.1| adenylate kinase [Chaetomium globosum CBS 148.51]
          Length = 275

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 24/214 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K N   L+TGDMLR++V + T LG++ K  M++G L+S
Sbjct: 41  IRMILIGPPGAGKGTQAPKIKEKFNCCHLATGDMLRSQVAKKTTLGREAKKIMDAGGLVS 100

Query: 61  DAIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ + +    +C  GFILDG+PRTV QA+ L   +     ++   +EL+++D  
Sbjct: 101 DDIVIGMIKEELDNNKECKGGFILDGFPRTVPQAEGLDKMLRERSQSLQHAVELKIDDQL 160

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR+  Y K 
Sbjct: 161 LVSRITGRLVHP-ASGRSYHTTFNPPKVHMTDDITGEPLIQRSDDNAEALKKRLATYHKQ 219

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             P+  YYR  G    ID      +V +S+ ++ 
Sbjct: 220 TAPVVDYYRKTGIWQAIDAAQAPGQVWKSLQAIF 253


>gi|291535449|emb|CBL08561.1| Adenylate kinase [Roseburia intestinalis M50/1]
 gi|291537909|emb|CBL11020.1| Adenylate kinase [Roseburia intestinalis XB6B4]
          Length = 214

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K ++P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKQIADKYHIPHISTGDIFRANIKNGTELGNKAKQYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI+  DC++GF+LDG+PRT+ QA++L A +  ++  +D  I++ V D ++
Sbjct: 61  DELTCDLVMDRIKQDDCENGFVLDGFPRTIPQAEALTAALEKINEKMDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +       +R DDK +   KR+  Y +   
Sbjct: 121 VNRMSGRRACLNCGATYHIVSIPTKVEGICDRCGQPVVLRDDDKPETVQKRLTVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+    L  +DG   M++V   I ++L
Sbjct: 181 PLIDYYKKQSILKTVDGTQPMEKVFADIVAIL 212


>gi|269128495|ref|YP_003301865.1| adenylate kinase [Thermomonospora curvata DSM 43183]
 gi|268313453|gb|ACY99827.1| adenylate kinase [Thermomonospora curvata DSM 43183]
          Length = 217

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 113/205 (55%), Gaps = 21/205 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  ++  L+VP++STGD+ RA V   T LG++ K  M+ G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAQFIASHLSVPKISTGDIFRANVSSGTELGRKAKQYMDRGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFI-SNMDCAIDAVIELRVEDAS 119
           D I   +V DR+   D   GF+LDG+PR V QA++L   + S     +D V+ELRV++  
Sbjct: 61  DEITIAMVRDRLAEKDAADGFLLDGFPRNVPQAQTLKKILDSEWGTRLDVVLELRVDEEE 120

Query: 120 MFKRIQVR--------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
           + +R+  R                    + +    +   R DDK DV   R+E Y++   
Sbjct: 121 VVRRLSGRRTCSQCGKIWHVDWDDKQDDICDDCGGQLFQRDDDKEDVVRHRLEVYQEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS 184
           PL S+Y D G L  ID    ++EV+
Sbjct: 181 PLVSFYADEGILVGIDATGPIEEVT 205


>gi|310779575|ref|YP_003967908.1| Adenylate kinase [Ilyobacter polytropus DSM 2926]
 gi|309748898|gb|ADO83560.1| Adenylate kinase [Ilyobacter polytropus DSM 2926]
          Length = 213

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L +K  +PQ+STGD+LR+ +   T +G + K  M+ G L+ 
Sbjct: 1   MNIMLFGAPGAGKGTQAKFLIEKYGIPQISTGDILRSAIADGTKMGLEAKKYMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC  GFILDG+PRT+ QA++L   +  M  ++D VI L V D  +
Sbjct: 61  DSTIIGIIRDRLAEEDCKKGFILDGFPRTLAQAEALEELMKEMSISLDKVISLNVPDEMI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R +                     +    E   R DD  +   KR+  Y     
Sbjct: 121 VGRITGRRVCKSCGASFHVEFNPSKEEGKCDFCGGELITRKDDTAETVEKRLGEYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+  G L  +DG  D+ EV++ I S+L
Sbjct: 181 PLFDFYKGKGVLAELDGTKDVAEVTKDIVSIL 212


>gi|296119341|ref|ZP_06837909.1| adenylate kinase [Corynebacterium ammoniagenes DSM 20306]
 gi|295967733|gb|EFG80990.1| adenylate kinase [Corynebacterium ammoniagenes DSM 20306]
          Length = 181

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/167 (38%), Positives = 101/167 (60%), Gaps = 10/167 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+KLNVP +STGD+ RA +   T LG + K  M++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSEKLNVPHISTGDLFRANIGEGTPLGVEAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             +  ++V DR+   D  +GF+LDG+PRTV+QA+ L+  ++  + ++D V+  +V D  +
Sbjct: 61  TDVTARMVEDRLSQDDAANGFLLDGFPRTVEQAEILNDLLAKNNQSLDGVLNFQVSDDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
            +R+  R           R+DD  +    R+  YR   +PL  +Y D
Sbjct: 121 VERMLAR----------GRADDNEETIRTRMSVYRDETMPLIDHYGD 157


>gi|328884447|emb|CCA57686.1| Adenylate kinase [Streptomyces venezuelae ATCC 10712]
          Length = 215

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 109/206 (52%), Gaps = 22/206 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA  L++ L++P +STGD+ RA + + T LG + +  M++G L+ 
Sbjct: 1   MRIVLVGPPGAGKGTQAAYLAKNLDIPHISTGDLFRANISQGTALGLEAQSYMKAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +  DR+  PD  +GF+LDG+PR V QA++L   +      +DAV++L V +  +
Sbjct: 61  DSVTIGMAKDRMEQPDAANGFLLDGFPRNVAQAEALDEILKAGHVQLDAVLDLEVPEDEV 120

Query: 121 FKRIQVR----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            KRI  R                      V +    E   R DD  +   +R+E Y    
Sbjct: 121 VKRIAGRRICRNDSAHVFHVTYNAPKTEGVCDVCGGELYQRDDDSEETVRRRLEVYHTET 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVS 184
            P+  YYR    +  I  +  +DEV+
Sbjct: 181 EPIIDYYRSQNLVETISALGKVDEVT 206


>gi|253682437|ref|ZP_04863234.1| adenylate kinase [Clostridium botulinum D str. 1873]
 gi|253562149|gb|EES91601.1| adenylate kinase [Clostridium botulinum D str. 1873]
          Length = 216

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ R  +   T LG + K  M+ G L+ 
Sbjct: 1   MRMILLGPPGAGKGTQAKLISEKYSIPHISTGDIFRKNISEKTPLGVKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC +GF+LDG+PRTV QA++L  F++  + ++D  + + V  + +
Sbjct: 61  DELTIDLVNDRLTHEDCKTGFLLDGFPRTVKQAEALENFLNKNNQSLDTALLINVPSSFI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +   +E   R DD  +   +RIE Y +   
Sbjct: 121 LERMTGRRVCPSCGASYHIKFNPPKIEGICDVCKAEVIQRKDDTEETVKERIEVYDRQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     L+++DG   +D+V  +I
Sbjct: 181 PLVDFYASKDQLFVVDGTQSIDQVFETI 208


>gi|323357352|ref|YP_004223748.1| adenylate kinase [Microbacterium testaceum StLB037]
 gi|323273723|dbj|BAJ73868.1| adenylate kinase [Microbacterium testaceum StLB037]
          Length = 198

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 104/190 (54%), Gaps = 6/190 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GP GSGKGTQ  R+++   +P +STGD+ RA V   T LGKQV   +++G L+ D
Sbjct: 4   RLLIVGPQGSGKGTQGVRIAEAFGIPVVSTGDVFRANVAEGTELGKQVTSIIDAGDLVPD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            + + VV DR+  PD   GF+LDGYPR + Q   L  F+   D ++DAVI L V      
Sbjct: 64  ELTSAVVRDRLSQPDAGEGFLLDGYPRNLAQVMHLDEFLGGRDESLDAVIALVVPRDESL 123

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R +E        R+DD  +    R+  Y +   P+   Y   G +  IDG+  +D
Sbjct: 124 ARLTARAVE------QGRADDTAEAIETRLNIYERETAPILGVYGTRGIVDEIDGVGGLD 177

Query: 182 EVSRSIDSLL 191
           EV+  + + L
Sbjct: 178 EVTERVFAAL 187


>gi|124024015|ref|YP_001018322.1| adenylate kinase [Prochlorococcus marinus str. MIT 9303]
 gi|166980348|sp|A2CC47|KAD_PROM3 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123964301|gb|ABM79057.1| Adenylate kinase [Prochlorococcus marinus str. MIT 9303]
          Length = 182

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 110/195 (56%), Gaps = 19/195 (9%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL     +  LSTGD+LRAEV   T LG++    M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAERLCAAHELMHLSTGDLLRAEVGAKTPLGQEAAAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V ++++  +   G++LDG+PRT+ QA +L   +  +   I+AV+ L + DA + 
Sbjct: 64  ELVLAIVENQLK--NQSGGWLLDGFPRTLIQATALEPLLEELKQPIEAVVLLELNDAVLI 121

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           RSDD   V   R+E YR+   PL  +YR  G L  +       
Sbjct: 122 ERLISRG----------RSDDNESVIRNRLEVYREKTAPLIDHYRQQGLLQTV------- 164

Query: 182 EVSRSIDSLLVSVRK 196
           E   SI+S+ +S+ K
Sbjct: 165 EAQGSIESIAISIEK 179


>gi|261192922|ref|XP_002622867.1| adenylate kinase cytosolic [Ajellomyces dermatitidis SLH14081]
 gi|239589002|gb|EEQ71645.1| adenylate kinase cytosolic [Ajellomyces dermatitidis SLH14081]
 gi|239613586|gb|EEQ90573.1| adenylate kinase cytosolic [Ajellomyces dermatitidis ER-3]
 gi|327352653|gb|EGE81510.1| adenylate kinase 1 [Ajellomyces dermatitidis ATCC 18188]
          Length = 277

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 114/209 (54%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K     L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPKIKEKFCACHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L + +++    +   IEL+++DA 
Sbjct: 106 DEIMVNMIKHELENNKECQNGFILDGFPRTVAQAERLDSMLNSRGQKLQHAIELQIDDAL 165

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  D   KR++ Y    
Sbjct: 166 LVARITGRLVHPASGRSYHKIFNPPKEAMKDDITGEPLVQRSDDNADALSKRLKTYHSQT 225

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY+  G    ID   +  +V +S+
Sbjct: 226 EPVVGYYKTTGIWKGIDASQEPGQVWKSL 254


>gi|307129962|ref|YP_003881978.1| adenylate kinase [Dickeya dadantii 3937]
 gi|306527491|gb|ADM97421.1| adenylate kinase [Dickeya dadantii 3937]
          Length = 214

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++          +D VIE  V D  +
Sbjct: 61  DELVIALVKERIAQDDCRNGFLLDGFPRTIPQADAM----KEAGIKVDHVIEFDVPDELI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +A   E ++R DD+ D   KR+  Y +   
Sbjct: 117 VERIIGRRVHAASGRVYHVKFNPPKVEGKDDATGEELTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR-----DMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY+     +    + IDG   + +VS  +  +L
Sbjct: 177 PLVNYYQQEAAANHTSYHKIDGTRPVSDVSAELARIL 213


>gi|121604822|ref|YP_982151.1| adenylate kinase [Polaromonas naphthalenivorans CJ2]
 gi|166980344|sp|A1VNK2|KAD_POLNA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|120593791|gb|ABM37230.1| Adenylate kinase [Polaromonas naphthalenivorans CJ2]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 105/187 (56%), Gaps = 17/187 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG + K  M+SG L+S
Sbjct: 1   MKLILLGAPGAGKGTQATFICQKYGIPQISTGDMLRAAVKAGTPLGIEAKKVMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V +RI  PDC  GF+ DG+PRT+ QA ++ A      ++  +D   +A+IE  
Sbjct: 61  DDLIINLVKERIAQPDCAQGFLFDGFPRTIPQADAMKAAGVKIDYVLEIDVPFEAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       +   +V  L+ +  E  + R DDK +   KR+E Y     PL +
Sbjct: 121 SGRRSHSASGRTYHVKYNPPKVEGLDDVTGEPLIQREDDKEETVAKRLEVYSAQTRPLVA 180

Query: 164 YYRDMGC 170
           YY D   
Sbjct: 181 YYSDWAT 187


>gi|312904663|ref|ZP_07763818.1| adenylate kinase [Enterococcus faecalis TX0635]
 gi|310632015|gb|EFQ15298.1| adenylate kinase [Enterococcus faecalis TX0635]
          Length = 231

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 29/218 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++     +P +STGDM RA +   T LG + K  ++ G L+ 
Sbjct: 16  MNLILMGLPGAGKGTQAEKIIDTYGIPHISTGDMFRAAMKNETALGLEAKSYIDKGELVP 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD D GF+LDG+PRT+DQAK+L   +  ++  IDAVI++ VE+  +
Sbjct: 76  DEVTNGIVKERLAEPDTDKGFLLDGFPRTLDQAKALDTMLKELNKKIDAVIDIHVEEDVL 135

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
            +R+  R +                           E   R DDK +    R+    ++ 
Sbjct: 136 TERLAGRFICRTCGATYHKLFNPPKVEGTCDRCGGHEFYQREDDKPETVKNRLAVNIESS 195

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
            P+ ++Y++ G ++ IDG       +R ID++   V+K
Sbjct: 196 APILAFYKEQGLMHTIDG-------NREIDTVFSDVKK 226


>gi|77462280|ref|YP_351784.1| adenylate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126461156|ref|YP_001042270.1| adenylate kinase [Rhodobacter sphaeroides ATCC 17029]
 gi|77386698|gb|ABA77883.1| Adenylate kinase [Rhodobacter sphaeroides 2.4.1]
 gi|126102820|gb|ABN75498.1| Adenylate kinase [Rhodobacter sphaeroides ATCC 17029]
          Length = 217

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 117/211 (55%), Gaps = 23/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA RL +   + QLSTGDMLR      + +G++    M+ G L++D 
Sbjct: 4   VILLGPPGAGKGTQAKRLEESRGMVQLSTGDMLREAKTSGSEMGRRAAEVMDRGELVTDE 63

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ ++++ P    GFI DG+PRT+ QA +L   ++ M   +DAVIE++V+DA++  
Sbjct: 64  IVIGLIREKLQSP-AAGGFIFDGFPRTLKQADALGELLAQMGQGLDAVIEMQVDDAALVA 122

Query: 123 RIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                  +E +     +++   R+DD  +   KR+  Y K   P
Sbjct: 123 RITGRYSCGSCGAVYHDDTKPTKVEGVCDVCGSTDLRRRADDTAEALSKRLMEYYKKTSP 182

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY   G L  +DG+ +MD VS +I  +L
Sbjct: 183 LIGYYYAKGQLSSVDGLAEMDAVSAAISKVL 213


>gi|332039445|gb|EGI75855.1| adenylate kinase [Hylemonella gracilis ATCC 19624]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 102/182 (56%), Gaps = 17/182 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  L +K  +PQ+STGDMLRA V   T LG Q K  MESG L+S
Sbjct: 1   MRLILLGAPGAGKGTQAAFLCRKYGIPQISTGDMLRAAVKAGTPLGLQAKAVMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIEL- 113
           D ++  +V +RI  PDC  GF+ DG+PRT+ QA+++ A      ++  +D   DA+IE  
Sbjct: 61  DDLIINLVKERIAQPDCAPGFLFDGFPRTIPQAEAMKAAGVKLDYVLEIDVPFDAIIERM 120

Query: 114 --RVEDASMFKRIQVRVLEAIASEKS--------VRSDDKYDVFLKRIENYRKTILPLSS 163
             R    +  +   ++    IA+ K          R DDK +   KR++ Y     PL  
Sbjct: 121 SGRRSHPASGRTYHIKFNPPIAAGKDDITGEPLVQRDDDKEETVKKRLDVYSAQTRPLVD 180

Query: 164 YY 165
           YY
Sbjct: 181 YY 182


>gi|257470853|ref|ZP_05634943.1| adenylate kinase [Fusobacterium ulcerans ATCC 49185]
 gi|317065056|ref|ZP_07929541.1| adenylate kinase [Fusobacterium ulcerans ATCC 49185]
 gi|313690732|gb|EFS27567.1| adenylate kinase [Fusobacterium ulcerans ATCC 49185]
          Length = 213

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+  G PG+GKGTQA  L +K  +PQ+STGD+LRA +   T +G + K  M+ G L+ 
Sbjct: 1   MNIMLFGAPGAGKGTQAKFLIEKYGIPQISTGDILRAAIKEGTAMGLEAKKFMDDGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+ +  ++ DR+   DC  GFILDG+PRT+ QA++L   +  M+  +D VI L V D  +
Sbjct: 61  DSTIIGIIKDRLSEDDCKKGFILDGFPRTLAQAEALEVLMKEMNIKLDKVISLNVPDELI 120

Query: 121 FKRIQVRVLEAI---------------------ASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R +  +                      ++   R DD  +   KR+  Y     
Sbjct: 121 LGRIVGRKVCPVCGASFHVEFNPPKVEGKCDLCGADLITRKDDNAETVTKRLTEYHSQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+  G L  IDG   M+++++ I  +L
Sbjct: 181 PLFDFYQSRGVLVDIDGTKKMEDITKEIFDIL 212


>gi|221638134|ref|YP_002524396.1| adenylate kinase [Rhodobacter sphaeroides KD131]
 gi|221158915|gb|ACL99894.1| Adenylate kinase [Rhodobacter sphaeroides KD131]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 117/211 (55%), Gaps = 23/211 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA RL +   + QLSTGDMLR      + +G++    M+ G L++D 
Sbjct: 5   VILLGPPGAGKGTQAKRLEESRGMVQLSTGDMLREAKTSGSEMGRRAAEVMDRGELVTDE 64

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ ++++ P    GFI DG+PRT+ QA +L   ++ M   +DAVIE++V+DA++  
Sbjct: 65  IVIGLIREKLQSP-AAGGFIFDGFPRTLKQADALGELLAQMGQGLDAVIEMQVDDAALVA 123

Query: 123 RIQVRV-----------------LEAI-----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           RI  R                  +E +     +++   R+DD  +   KR+  Y K   P
Sbjct: 124 RITGRYSCGSCGAVYHDDTKPTKVEGVCDVCGSTDLRRRADDTAEALSKRLMEYYKKTSP 183

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY   G L  +DG+ +MD VS +I  +L
Sbjct: 184 LIGYYYAKGQLSSVDGLAEMDAVSAAISKVL 214


>gi|293115542|ref|ZP_05792011.2| adenylate kinase [Butyrivibrio crossotus DSM 2876]
 gi|292809387|gb|EFF68592.1| adenylate kinase [Butyrivibrio crossotus DSM 2876]
          Length = 221

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 118/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++  K N+P +STGD+ RA +  NT LG++ K  M+ G L+ 
Sbjct: 8   MKIIMLGAPGAGKGTQADKICAKYNIPHISTGDIFRANIKNNTELGQKAKSYMDKGELVP 67

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DRI+  DC +G++LDG+PRT+ QA++L A ++ ++  +D  I + V D ++
Sbjct: 68  DELVVDLVVDRIKADDCTNGYVLDGFPRTIPQAEALDAALAAINDKVDYAINVEVPDENI 127

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +   ++  +R DDK +    R+  Y +   
Sbjct: 128 INRMSGRRACVACGATYHIVHIPTKVDGVCDKCGAKLILRDDDKPETVKNRLNVYHEQTQ 187

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L+ +DG   M++V  SI S+L
Sbjct: 188 PLIDYYTAKNVLHEVDGTKAMEDVFSSIVSIL 219


>gi|291408853|ref|XP_002720749.1| PREDICTED: adenylate kinase 2 [Oryctolagus cuniculus]
          Length = 239

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 106/197 (53%), Gaps = 21/197 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA RL++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDNLMEKRKEKLDSVIEFSIPDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIHPTSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLEAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDG 176
           PL  YYR  G    +D 
Sbjct: 196 PLVEYYRKRGIHAAVDA 212


>gi|225684861|gb|EEH23145.1| adenylate kinase isoenzyme 2, mitochondrial [Paracoccidioides
           brasiliensis Pb03]
          Length = 276

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA  + +K  V  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPNIKEKFCVCHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     DC +GFILDG+PRTV QA+ L   + +    +   IEL+++DA 
Sbjct: 106 DEIMVNMIKHELETNKDCQNGFILDGFPRTVAQAERLDGMLDSRGQKLQHAIELQIDDAL 165

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR++ Y   
Sbjct: 166 LVSRITGRLVHP-ASGRSYHKIFNPPKEPMKDDITGEPLIQRSDDNAEALQKRLKTYHSQ 224

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 225 TAPIVGYYKKTGIWTGIDASQEPGQVWKSL 254


>gi|251792232|ref|YP_003006954.1| adenylate kinase [Aggregatibacter aphrophilus NJ8700]
 gi|247533621|gb|ACS96867.1| adenylate kinase (ATP-AMP transphosphorylase) [Aggregatibacter
           aphrophilus NJ8700]
          Length = 214

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLR+ +   T LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFAIPQISTGDMLRSAIKAGTELGKQAKTLMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+  PDC  GF+LDG+PRT+ QA +L     +   AID V+E  V D  +
Sbjct: 61  DDLIISLVKERVAQPDCAKGFLLDGFPRTIPQADAL----KSAGIAIDYVLEFDVPDEVI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +    +  +R+DDK +  L R++ Y  T  
Sbjct: 117 VERMSGRRVHQPSGRSYHVIYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLKVYHSTTK 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + +DG   +++VS+ +D +L
Sbjct: 177 PLVDYYQAEAKAGNTQYFRLDGTQKVEDVSKELDKIL 213


>gi|70991300|ref|XP_750499.1| adenylate kinase [Aspergillus fumigatus Af293]
 gi|74669525|sp|Q4WJ21|KAD1_ASPFU RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|224493045|sp|B0XPW9|KAD1_ASPFC RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|66848131|gb|EAL88461.1| adenylate kinase, putative [Aspergillus fumigatus Af293]
 gi|159130970|gb|EDP56083.1| adenylate kinase, putative [Aspergillus fumigatus A1163]
          Length = 257

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL +K  V  L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 43  MRIVLMGPPGAGKGTQAPRLKEKYCVCHLATGDMLRSQVAKKTELGKEAKKIMDQGGLVS 102

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   +   +  +   IEL+++DA 
Sbjct: 103 DEIMVNMIKNELDTNSECKNGFILDGFPRTVAQAERLDDMLEARNQKLQHAIELQIDDAL 162

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR+  Y   
Sbjct: 163 LVARITGRLVHP-ASGRSYHKIFNPPKNDMKDDVTGEPLIQRSDDNAETLKKRLSTYHAQ 221

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 222 TAPVVEYYKKTGIWRGIDASQEPGQVWKSL 251


>gi|310288003|ref|YP_003939262.1| Adenylate kinase [Bifidobacterium bifidum S17]
 gi|311064876|ref|YP_003971602.1| adenylate kinase [Bifidobacterium bifidum PRL2010]
 gi|309251940|gb|ADO53688.1| Adenylate kinase [Bifidobacterium bifidum S17]
 gi|310867196|gb|ADP36565.1| Adk Adenylate kinase [Bifidobacterium bifidum PRL2010]
          Length = 187

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 103/187 (55%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  L++   +P +STGD+ R  +   T LG +     + G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLAEHYGIPAISTGDIFRYNIKNKTELGLEALKYTDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+ + D  +G+ILDGYPR   Q K+L A +  +   +D V+ L  +   +
Sbjct: 61  DELTNKIVKDRLAMDDAKNGWILDGYPRNASQVKALDAMLEELGTPLDKVVALDADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +RI  R      +++  RSDD  +   KR+  Y K   PL   Y+  G L  IDG+ D+
Sbjct: 121 MQRIAKR------AQEQGRSDDTPEAIAKRLATYAKETAPLLDTYKSRGQLVAIDGVGDI 174

Query: 181 DEVSRSI 187
           D +  +I
Sbjct: 175 DAIQANI 181


>gi|300871913|ref|YP_003786786.1| adenylate kinase [Brachyspira pilosicoli 95/1000]
 gi|300689614|gb|ADK32285.1| adenylate kinase [Brachyspira pilosicoli 95/1000]
          Length = 204

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 103/175 (58%), Gaps = 12/175 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + IIF+G PGSGKGTQ+  + ++ ++  +STGDM R  +   T LGK  KG M+ G L+ 
Sbjct: 17  INIIFIGAPGSGKGTQSELIEKEYSISHISTGDMFRENIANGTELGKTAKGYMDKGELVP 76

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++V  ++ DR++  DC  GF+LDGYPRT++QAK L   +  ++  IDA+I L V +  +
Sbjct: 77  DSLVIDMLFDRLKKDDCKKGFMLDGYPRTMEQAKELDKLLEKLNYKIDAIINLSVAENII 136

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIID 175
            KR+  R           RSDD  +    RI+ +     P+  YY+D   +YIID
Sbjct: 137 IKRLLNR----------GRSDDNEETIKNRIKVFESQSKPVLEYYKDK--VYIID 179


>gi|302669982|ref|YP_003829942.1| adenylate kinase Adk [Butyrivibrio proteoclasticus B316]
 gi|302394455|gb|ADL33360.1| adenylate kinase Adk [Butyrivibrio proteoclasticus B316]
          Length = 214

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  ++ K N+P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAQMIADKYNIPHISTGDIFRANIKNGTELGKKAKEYMDKGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  Q++ DR+   DC +G++LDG+PRT+ QA  L + ++ +   +D  + + V D ++
Sbjct: 61  DELTVQLLLDRVANEDCKNGYVLDGFPRTIPQADVLDSELTKLGDKVDYAVNVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +   SE  +R DDK +    R+  Y +   
Sbjct: 121 VHRMSGRRACLKCGATYHIEHIPPKTEGICDKCGSELVLRDDDKPETVQNRLAVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY     L  +DG  DM EV   I ++L
Sbjct: 181 PLIEYYDKKNILKTVDGTKDMQEVFSDIVNIL 212


>gi|212716590|ref|ZP_03324718.1| hypothetical protein BIFCAT_01519 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660294|gb|EEB20869.1| hypothetical protein BIFCAT_01519 [Bifidobacterium catenulatum DSM
           16992]
          Length = 186

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 109/187 (58%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +   T LG +    ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNIKNKTELGVEALKYIDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+ + D  +G+ILDGYPR   Q ++L A +++++  +DAV+ L  +   +
Sbjct: 61  DELTNKIVKDRLAMDDAKNGWILDGYPRNASQVEALDAILTDLNTPLDAVVALDADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R      +E   RSDD  +   KR++ Y K   PL + Y + G L   +G+  +
Sbjct: 121 MERMKKR------AEIEGRSDDTPEAIAKRLDVYAKETAPLLTTYEERGLLKTFNGVGSV 174

Query: 181 DEVSRSI 187
           +E+  +I
Sbjct: 175 EEIQSTI 181


>gi|293375410|ref|ZP_06621691.1| adenylate kinase [Turicibacter sanguinis PC909]
 gi|325844454|ref|ZP_08168181.1| adenylate kinase [Turicibacter sp. HGF1]
 gi|292645963|gb|EFF63992.1| adenylate kinase [Turicibacter sanguinis PC909]
 gi|325489128|gb|EGC91512.1| adenylate kinase [Turicibacter sp. HGF1]
          Length = 216

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 112/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+F+GPPG+GKGTQA ++ +   +P +STGDM R  +   T LG + K  M+ G+L+ 
Sbjct: 1   MKIVFMGPPGAGKGTQAEKIIETYQIPHISTGDMFRKAIKDQTELGMEAKRYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC SGF+LDG+PRTVDQAK+L   ++++D  ID VI + V+   +
Sbjct: 61  DHVTIGIVKDRLSESDCKSGFLLDGFPRTVDQAKALDEILTSLDSKIDYVINIDVDLNIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     V +    E   R DD  +    R++ Y     
Sbjct: 121 KERLTGRRICRSCGATYHKIFNPSAVEGVCDKCGGELYQRKDDNEETVGNRLDVYVNQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  I+G   +D V   I ++L
Sbjct: 181 PLLDYYSLAGNLVNINGQQSIDLVFEEIQNVL 212


>gi|78221867|ref|YP_383614.1| adenylate kinase [Geobacter metallireducens GS-15]
 gi|78193122|gb|ABB30889.1| Adenylate kinase [Geobacter metallireducens GS-15]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 114/214 (53%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +IFLGPPG+GKGTQA  L     +PQ+STGD+LR+ V   T LG   K  M++GSL+ 
Sbjct: 8   MNLIFLGPPGAGKGTQANLLVGTYGIPQISTGDILRSAVANQTSLGITAKSYMDAGSLVP 67

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +R+   DC +GFILDG+PRTV QA +L   +     +I  VI   V+ A +
Sbjct: 68  DEVVVGIVNERLAADDCAAGFILDGFPRTVAQADALGGMLQGAGRSIAHVISFEVDYAVL 127

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +                     ++   E   R DDK +   +R++ Y +  +
Sbjct: 128 VDRLTGRRMCRACGRGFHVLYDRPSVEGRCDSCGGELYQRDDDKVETIRRRLDVYDEQTV 187

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY     L  +D +  ++ VS+SI +++ S
Sbjct: 188 PLKLYYERASLLRKVDALGSIESVSQSIQNIVAS 221


>gi|312216838|emb|CBX96787.1| similar to adenylate kinase cytosolic [Leptosphaeria maculans]
          Length = 277

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 111/210 (52%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA R+ +K     L+TGDMLRA+V   T LG++ K  M++G L+S
Sbjct: 44  VRMILMGPPGAGKGTQAPRIKEKFCACHLATGDMLRAQVAAKTTLGREAKKIMDAGGLVS 103

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C  GFILDG+PRTV QA+ L   +   +  +   +EL+++D  
Sbjct: 104 DEIMVNMIRTELENNEECRKGFILDGFPRTVTQAEKLDGMLEATNKPLQHAVELQIDDGL 163

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR+  Y   
Sbjct: 164 LVSRITGRLVHP-ASGRSYHKIFNPPKAPMTDDVTGEPLIQRSDDNEDTLKKRLSTYHAQ 222

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+ +YY+  G    ID   D  +V +S+
Sbjct: 223 TAPVVAYYQKTGIWKPIDASQDPGQVWKSL 252


>gi|296449778|ref|ZP_06891547.1| adenylate kinase [Clostridium difficile NAP08]
 gi|296877842|ref|ZP_06901864.1| adenylate kinase [Clostridium difficile NAP07]
 gi|296261376|gb|EFH08202.1| adenylate kinase [Clostridium difficile NAP08]
 gi|296431142|gb|EFH16967.1| adenylate kinase [Clostridium difficile NAP07]
          Length = 221

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 109/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 6   MRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 65

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 66  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 125

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 126 VSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 185

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL +YY   G +  I G   +D+V   I + L S
Sbjct: 186 PLVNYYSKQGIIADIKGDQAIDKVFEDIVTALGS 219


>gi|255654183|ref|ZP_05399592.1| adenylate kinase [Clostridium difficile QCD-23m63]
          Length = 216

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 109/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 61  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 121 VSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL +YY   G +  I G   +D+V   I + L S
Sbjct: 181 PLVNYYSKQGIIADIKGDQAIDKVFEDIVTALGS 214


>gi|226287765|gb|EEH43278.1| adenylate kinase cytosolic [Paracoccidioides brasiliensis Pb18]
          Length = 276

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA  + +K  V  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPNIKEKFCVCHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     DC +GFILDG+PRTV QA+ L   + +    +   IEL+++DA 
Sbjct: 106 DEIMVNMIKHELETNKDCQNGFILDGFPRTVAQAERLDGMLDSRGQKLQHAIELQIDDAL 165

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR++ Y   
Sbjct: 166 LVARITGRLVHP-ASGRSYHKIFNPPKEPMKDDITGEPLIQRSDDNAEALQKRLKTYHSQ 224

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 225 TAPIVGYYKKTGIWTGIDASQEPGQVWKSL 254


>gi|119952574|ref|YP_950307.1| adenylate kinase [Arthrobacter aurescens TC1]
 gi|119951704|gb|ABM10613.1| Adenylate kinase (ATP-AMP transphosphorylase) [Arthrobacter
           aurescens TC1]
          Length = 192

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 111/186 (59%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           +++ +GPPGSGKGTQA R+S +L++  +STGD+ RA V   T LG + K  ME+G  + D
Sbjct: 3   KMLIIGPPGSGKGTQAERISGRLSIVAISTGDIFRANVKDGTPLGVEAKKYMEAGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N++V DR+   D + GF+LDGYPRT +Q   L   ++  D  +D V++L  +D  + 
Sbjct: 63  SVTNKMVRDRLAETDVEDGFLLDGYPRTTEQVDYLDQILARGDQKLDFVLQLTADDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      ++K+ RSDD   V   R++ Y +    + + Y + G L  IDG+  +D
Sbjct: 123 ARLLGR------AKKTGRSDDNEAVIRYRLDLYHEQTEGVVAQYAERGILTQIDGIGQID 176

Query: 182 EVSRSI 187
           EV+  +
Sbjct: 177 EVTERV 182


>gi|260574989|ref|ZP_05842991.1| adenylate kinase [Rhodobacter sp. SW2]
 gi|259022994|gb|EEW26288.1| adenylate kinase [Rhodobacter sp. SW2]
          Length = 234

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 109/214 (50%), Gaps = 22/214 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I LGPPG+GKGTQA  L     + QLSTGD+LRA V   +  G+  K  M +G L+SD 
Sbjct: 19  VILLGPPGAGKGTQARMLEADFGLVQLSTGDLLRAAVAAGSEAGRAAKAVMAAGQLVSDE 78

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ +R+  PD   G ILDG+PRT  QA++L   ++     + AV+ L V+DA+M  
Sbjct: 79  IVLAILRERMAAPDTARGVILDGFPRTDAQARALDGLLAEQGQKVTAVVSLEVDDAAMVG 138

Query: 123 RIQVRVLEAIASEK----------------------SVRSDDKYDVFLKRIENYRKTILP 160
           RI  R   A   E                       + R+DD  D  L R++ Y     P
Sbjct: 139 RISGRHTCAACGEGYHDQFKLPAQAGVCDKCGGTTFTRRADDNADTVLARLQAYHAQTAP 198

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
           L +YY   G L+ ID M  + ++  ++ +L   V
Sbjct: 199 LIAYYEGRGVLHRIDAMGAIADIRSTLAALAGGV 232


>gi|331000997|ref|ZP_08324633.1| adenylate kinase [Parasutterella excrementihominis YIT 11859]
 gi|329569772|gb|EGG51536.1| adenylate kinase [Parasutterella excrementihominis YIT 11859]
          Length = 217

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 117/216 (54%), Gaps = 34/216 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA R+ +   +PQ+STGDMLRA V   T LG   K  M++G L+S
Sbjct: 1   MRLILLGAPGAGKGTQAARICEHYGIPQISTGDMLRAAVKAGTPLGLAAKKIMDAGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R+  PDC +GF+ DG+PRT+ QA++L          ID V+E+ V D  +
Sbjct: 61  DDIIIGLVKERLEKPDCKNGFLFDGFPRTIPQAEAL----VKAGIPIDDVVEIAVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +R+  R +  +AS ++                       R DDK +   KR+E Y    
Sbjct: 117 LERMSGRRVH-VASGRTYHVKFNPPKVEGVDDVTGEPLIQRPDDKEETVKKRLEVYHTQT 175

Query: 159 LPLSSYYR------DMGCLYI-IDGMLDMDEVSRSI 187
             L  +Y+      D    YI IDG+ D++EVSR I
Sbjct: 176 EALVGFYQSLVAKGDSKTKYIKIDGVGDVNEVSRRI 211


>gi|121702295|ref|XP_001269412.1| adenylate kinase, putative [Aspergillus clavatus NRRL 1]
 gi|224493002|sp|A1CQR5|KAD1_ASPCL RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|119397555|gb|EAW07986.1| adenylate kinase, putative [Aspergillus clavatus NRRL 1]
          Length = 257

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 112/209 (53%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA RL +K  V  L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 43  MRIILMGPPGAGKGTQAPRLKEKYCVCHLATGDMLRSQVAKKTELGKEAKKIMDQGGLVS 102

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   +      +   +EL+++DA 
Sbjct: 103 DEIMVNMIKSELETNSECKNGFILDGFPRTVAQAERLDDMLEARKQKLQHAVELQIDDAL 162

Query: 120 MFKRIQVRV--------------------LEAIASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R+                    L+ I  E  + RSDD  +   KR+  Y    
Sbjct: 163 LVARITGRLVHPASGRSYHKIFNPPKNEMLDDITGEPLIQRSDDNAETLKKRLSTYHAQT 222

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY+  G    ID   +  +V +S+
Sbjct: 223 APVVDYYKKTGIWRGIDASQEPGQVWKSL 251


>gi|22297644|ref|NP_680891.1| adenylate kinase [Thermosynechococcus elongatus BP-1]
 gi|29427444|sp|Q8DML4|KAD_THEEB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|22293821|dbj|BAC07653.1| adenylate kinase [Thermosynechococcus elongatus BP-1]
          Length = 195

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 112/196 (57%), Gaps = 2/196 (1%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I  G PGSGKGTQA  L+  L +P +STGD+LRAE    TLLG+Q +  M+ G L+ 
Sbjct: 1   MRLILFGGPGSGKGTQAAILTTLLGIPHISTGDILRAERAAGTLLGQQAQSYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R++ PD  +G++LDG+PR   QA      + ++    D ++ L V  A +
Sbjct: 61  DQVIVDMVANRLQQPDTAAGWLLDGFPRNGAQAAVFEEMLKSIHQDYDYLLFLDVPAAIL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R   R  +A+  ++  RSDD  +  LKR++ Y +  LP+   Y        IDG   +
Sbjct: 121 QERALNRAKQAVNGQQ--RSDDTPETILKRLQVYERETLPMIQQYMSHPKFVPIDGTRTI 178

Query: 181 DEVSRSIDSLLVSVRK 196
           +EV+ +I + +  V +
Sbjct: 179 EEVTAAIQARIGEVNR 194


>gi|325577700|ref|ZP_08147975.1| adenylate kinase [Haemophilus parainfluenzae ATCC 33392]
 gi|301154775|emb|CBW14238.1| adenylate kinase [Haemophilus parainfluenzae T3T1]
 gi|325160445|gb|EGC72571.1| adenylate kinase [Haemophilus parainfluenzae ATCC 33392]
          Length = 214

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 114/218 (52%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI  PDC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRISQPDCANGFLLDGFPRTIPQADAL----KDSGVKIDYVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R+  Y K  
Sbjct: 117 VERMSGRRVHQ-ASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQT 175

Query: 159 LPLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++ VS+ +D +L
Sbjct: 176 SPLIDYYQAEAKAGNTQYFRLDGTQKVEAVSQELDKIL 213


>gi|326437659|gb|EGD83229.1| adenylate kinase 2 [Salpingoeca sp. ATCC 50818]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 107/194 (55%), Gaps = 23/194 (11%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + +GPPG+GKGTQA R+  +  V  L+TGDMLRA + + T LG+QVK  M SG L+SD I
Sbjct: 8   LLIGPPGAGKGTQAERIVDRYGVCHLATGDMLRAAIRQGTPLGRQVKEIMASGGLVSDEI 67

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++ D +  P+C  GF+LDG+PRT++QAK L   +      +DA +E  ++D+ + +R
Sbjct: 68  VVNLIRDNLDTPECSKGFLLDGFPRTLEQAKKLDELLDQRKVKLDAALEFAIKDSVLIER 127

Query: 124 IQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTILPL 161
           I+ R++   AS ++                       R DD  +   KR+  Y +   PL
Sbjct: 128 IEGRLIHK-ASGRTYHTKFNPPKVPGKDDVTGEDLYKRPDDNAESLKKRLAAYHEKTAPL 186

Query: 162 SSYYRDMGCLYIID 175
             YY   G L+ I+
Sbjct: 187 CDYYDKKGILHRIE 200


>gi|258591337|emb|CBE67636.1| Adenylate kinase (ATP-AMP transphosphorylase) [NC10 bacterium
           'Dutch sediment']
          Length = 215

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  L+ K +   +S GD+LR  V   +  G+  K  M  G+L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQARLLTAKCDGAHVSAGDLLRQAVADGSEWGRTAKSIMAQGALLP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++  R+R PDC  G+ILDG+PRT+ QA++L   +  +D  +D VI + V +  +
Sbjct: 61  DGVVIEIIEKRLRQPDCAGGYILDGFPRTLRQAEALSDVLKLLDAPLDRVISVEVSEDDL 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   RV  A  S   V                    R DDK D    R+  YR+   
Sbjct: 121 VSRLAGRRVCRACGSMFHVDTKPPVRIGACDNCGDPLFQRDDDKEDTIRHRLRVYREQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL +YY  MG L  IDG   ++E++R I
Sbjct: 181 PLIAYYNKMGLLRRIDGHGTIEEIARRI 208


>gi|225351024|ref|ZP_03742047.1| hypothetical protein BIFPSEUDO_02606 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158480|gb|EEG71722.1| hypothetical protein BIFPSEUDO_02606 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 186

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 109/187 (58%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +   T LG +    ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNIKNKTELGVEALKYIDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+ + D  +G+ILDGYPR   Q ++L A +++++  +DAV+ L  +   +
Sbjct: 61  DELTNKIVKDRLAMDDAKNGWILDGYPRNASQVEALDAILADLNTPLDAVVALDADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R      +E   RSDD  +   KR++ Y K   PL + Y + G L   +G+  +
Sbjct: 121 MERMKKR------AEIEGRSDDTPEAIAKRLDVYAKETAPLLTTYEERGLLKTFNGVGSV 174

Query: 181 DEVSRSI 187
           +E+  +I
Sbjct: 175 EEIQSTI 181


>gi|154336115|ref|XP_001564293.1| adenylate kinase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134061328|emb|CAM38352.1| putative adenylate kinase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 218

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 113/212 (53%), Gaps = 25/212 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+ +G PG GKGTQ+  + ++  +  LSTGDMLR  V RNT  GK  KG+M+SG L+S
Sbjct: 1   MKIVLMGAPGCGKGTQSSYMKERYGLCHLSTGDMLRDAVARNTTNGKLAKGAMDSGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +V D I+ P+C  G+ILDGYPRT+ QAK     + +    ID VI+  V D  +
Sbjct: 61  DDIVFGIVKDSIKNPECRYGYILDGYPRTLKQAK----MMEDAGEKIDKVIDFSVPDEVI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R +                     +    +   R DD++DV  KR+  Y++   
Sbjct: 117 LERTSGRWVHKSSGRTYHEVFRPPRTPGKDDVTGEDLHQRPDDRHDVCEKRLGIYKQETR 176

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  Y+   G   +I+    +DEV + I +LL
Sbjct: 177 PLVDYFTKEGVYSMINANQTVDEVRKVITALL 208


>gi|115385917|ref|XP_001209505.1| adenylate kinase cytosolic [Aspergillus terreus NIH2624]
 gi|121733191|sp|Q0C7Y1|KAD1_ASPTN RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|114187952|gb|EAU29652.1| adenylate kinase cytosolic [Aspergillus terreus NIH2624]
          Length = 257

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA R+ +K  V  L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 42  MRIILMGPPGAGKGTQAPRIKEKYCVCHLATGDMLRSQVAKKTELGKEAKKIMDQGGLVS 101

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   ++     +   IEL+++DA 
Sbjct: 102 DEIMVNMIKSELENNAECKNGFILDGFPRTVAQAERLDDMLAARQQKLQHAIELQIDDAL 161

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR+  Y   
Sbjct: 162 LVARITGRLVHP-ASGRSYHKIFNPPKQEMKDDITGEPLIQRSDDNAETLKKRLGTYHAQ 220

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 221 TAPVCDYYKKTGIWRGIDASQEPGQVWKSL 250


>gi|317968835|ref|ZP_07970225.1| adenylate kinase [Synechococcus sp. CB0205]
          Length = 182

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 113/190 (59%), Gaps = 12/190 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA +L++   +  LSTGD+LRAEV   + LGK+ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAQKLAESQGLLHLSTGDLLRAEVAAGSDLGKEAEAVMARGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  R RL +   G++LDG+PR V QA +L + +  +   I+ V+ + ++D  + 
Sbjct: 64  ALVLAIV--RSRLQNHSGGWLLDGFPRNVAQADALASLLEELGQQIELVVLMELDDGVLV 121

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R+DD  +V   R+E YR    PL +YYR+ G +  ++    +D
Sbjct: 122 QRLLSR----------GRADDNEEVIRHRLEVYRVQTEPLIAYYRERGLIAPVEAAGTVD 171

Query: 182 EVSRSIDSLL 191
            ++  I ++L
Sbjct: 172 AIADRIAAML 181


>gi|261867852|ref|YP_003255774.1| adenylate kinase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413184|gb|ACX82555.1| adenylate kinase (ATP-AMP transphosphorylase) [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 214

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLR+ +   T LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFAIPQISTGDMLRSAIKTGTELGKQAKTLMDAGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+  PDC  GF+LDG+PRT+ QA +L     +   AID V+E  V D  +
Sbjct: 61  DDLIISLVKERVAQPDCAKGFLLDGFPRTIPQADAL----KSAGIAIDYVLEFDVPDEVI 116

Query: 121 FKRIQVR------------VLEAIASEKS---------VRSDDKYDVFLKRIENYRKTIL 159
            +R+  R            V     +E           +R+DDK +  L R++ Y  T  
Sbjct: 117 VERMSGRRVHQPSGRSYHIVYNPPKTEGKDDVTGEDLIIRADDKPETVLDRLKVYHTTTK 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + +DG   ++ VS+ +D +L
Sbjct: 177 PLVDYYQAEAKAGNVQYFRLDGTQKVEAVSKELDKIL 213


>gi|115655567|ref|XP_001177350.1| PREDICTED: similar to adenylate kinase 2 isoform 1
           [Strongylocentrotus purpuratus]
 gi|115655569|ref|XP_001177486.1| PREDICTED: similar to adenylate kinase 2 isoform 2
           [Strongylocentrotus purpuratus]
 gi|115935131|ref|XP_001177906.1| PREDICTED: similar to adenylate kinase 2 isoform 1
           [Strongylocentrotus purpuratus]
 gi|115935133|ref|XP_001178036.1| PREDICTED: similar to adenylate kinase 2 isoform 2
           [Strongylocentrotus purpuratus]
          Length = 249

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 21/213 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPG+GKG QA +L++K  V  L+TGDMLRA +   + LGK++K  ++SG L+SD +
Sbjct: 27  VLLGPPGAGKGVQAPKLAEKYCVCHLATGDMLRAVIASGSDLGKKLKVVLDSGKLVSDEL 86

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V +++ +++  P+C +GF+LDG+PRTV QA+ L   ++    A+D+V+E  ++D+ + KR
Sbjct: 87  VVEMIDNKLGAPECRNGFLLDGFPRTVVQAEKLDELLTKRKTALDSVVEFGIDDSLLVKR 146

Query: 124 IQVRVLEA--------------------IASEKSVRSDDKYDVFLK-RIENYRKTILPLS 162
           I  R++                      +  E  ++  D  +V LK R+E Y K   PL 
Sbjct: 147 ITGRLIHKPSGRSYHTEFSPPKKPMTDDVTGEPLIKRSDDNEVTLKTRLEAYHKQTAPLV 206

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            YY   G    +D     D V  SI ++    +
Sbjct: 207 DYYSKRGIHQRVDAARAPDAVFASIQTIFAKAQ 239


>gi|119025360|ref|YP_909205.1| adenylate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154486768|ref|ZP_02028175.1| hypothetical protein BIFADO_00593 [Bifidobacterium adolescentis
           L2-32]
 gi|118764944|dbj|BAF39123.1| adenylate kinase [Bifidobacterium adolescentis ATCC 15703]
 gi|154084631|gb|EDN83676.1| hypothetical protein BIFADO_00593 [Bifidobacterium adolescentis
           L2-32]
          Length = 186

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 106/187 (56%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GP G GKGTQA  LS+   +P +STGD+ R  +   T LG +    ++ G L+ 
Sbjct: 1   MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNIKNKTELGVEALKYIDKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V DR+ + D  +G+ILDGYPR   Q ++L A +  +D  +DAV+ L  +   +
Sbjct: 61  DELTNKIVKDRLAMDDAKNGWILDGYPRNASQVEALDAILGELDTPLDAVVALDADHDVL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R++ R      +E   RSDD  +   KR++ Y K   PL   Y+  G L   +G+  +
Sbjct: 121 MERMKKR------AEIEGRSDDTPEAIAKRLDVYAKETAPLLDIYQKRGLLKTFNGVGAV 174

Query: 181 DEVSRSI 187
           DE+  +I
Sbjct: 175 DEIQATI 181


>gi|242199954|gb|ACS88146.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199956|gb|ACS88147.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199958|gb|ACS88148.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199960|gb|ACS88149.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199962|gb|ACS88150.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199964|gb|ACS88151.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199966|gb|ACS88152.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199968|gb|ACS88153.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199970|gb|ACS88154.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199972|gb|ACS88155.1| adenylate kinase [Leptospira interrogans serovar Copenhageni]
 gi|242199974|gb|ACS88156.1| adenylate kinase [Leptospira interrogans serovar
           Icterohaemorrhagiae]
          Length = 167

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 106/172 (61%), Gaps = 6/172 (3%)

Query: 13  KGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRI 72
           KGTQA  L ++L++PQ+STGD+LR  V   T +G + K  M++G L+ D++V  ++ DRI
Sbjct: 1   KGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPDSVVIGIIKDRI 60

Query: 73  RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAI 132
           R  DC +GF+LDG+PRTV+QA++L   + N   +ID  I L+V DA + KR+  R     
Sbjct: 61  READCKNGFLLDGFPRTVEQAEALDTLLKNEGKSIDKAINLQVPDAELLKRLLGR----- 115

Query: 133 ASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVS 184
            +E   R+DD       R++NY K  LPL  +Y     L  ++G+  ++EV+
Sbjct: 116 -AEIEGRADDNEVTIKNRLDNYNKKTLPLLDFYATRKKLSQVNGVGSLEEVT 166


>gi|323141377|ref|ZP_08076268.1| adenylate kinase [Phascolarctobacterium sp. YIT 12067]
 gi|322414126|gb|EFY04954.1| adenylate kinase [Phascolarctobacterium sp. YIT 12067]
          Length = 216

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 110/204 (53%), Gaps = 21/204 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA +L  +  +P +STGDM RA V   T LGK+ K  M++G L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAEKLIDEFKIPHISTGDMFRAAVSAGTELGKEAKKYMDAGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V + +  P+C +GFILDG+PRT +QA +L   + ++   +  V+ + V D+ +
Sbjct: 61  DVVTIGIVREGLSKPECANGFILDGFPRTEEQAVALDGILKDLGIKLTGVVNISVPDSEL 120

Query: 121 FKR-IQVRVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R +  R+ +A  +   V                    R+DDK +  + R+  Y +   
Sbjct: 121 VARVVGRRICKACGATYHVSFNPSKVENVCDKCGGNLYQRNDDKEETVVNRLHAYHEQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEV 183
           PL  YY+  G    IDG+  +D+V
Sbjct: 181 PLIEYYKKQGLYKEIDGLQPIDKV 204


>gi|220913412|ref|YP_002488721.1| adenylate kinase [Arthrobacter chlorophenolicus A6]
 gi|259493989|sp|B8HCY6|KAD_ARTCA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|219860290|gb|ACL40632.1| adenylate kinase [Arthrobacter chlorophenolicus A6]
          Length = 192

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 108/183 (59%), Gaps = 6/183 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPGSGKGTQA R+S++L V  +STGD+ RA V   T LG + K  M++G  + D
Sbjct: 3   RMLIIGPPGSGKGTQAERISERLGVVAISTGDIFRANVKGETPLGIEAKKYMDNGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N++V DR+   D +SGF+LDGYPRT  Q   L   ++  +  +D V++L  +D  + 
Sbjct: 63  SVTNKMVRDRLSESDVESGFLLDGYPRTTAQVDYLDEILAKNEEKLDVVLQLTADDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R  E      + RSDD   V   R++ Y +    + + Y + G L  +DG+  +D
Sbjct: 123 HRLLGRAKE------TGRSDDNEAVIRHRLDLYHEQTEAVVAKYAERGILTQVDGIGPID 176

Query: 182 EVS 184
           EV+
Sbjct: 177 EVT 179


>gi|123892838|sp|Q28F55|KAD2_XENTR RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|89269042|emb|CAJ81568.1| adenylate kinase 2 [Xenopus (Silurana) tropicalis]
          Length = 241

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 115/218 (52%), Gaps = 21/218 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LG ++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C  GF+LDG+PRTV QA+ L   +      +D+VIE +V+D+ +
Sbjct: 78  DEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++ A                    +  E  + RSDD       R+E Y     
Sbjct: 138 VRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTS 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
           PL  YY+  G    +D     D V  SI +     R K
Sbjct: 198 PLVEYYQRHGIHTAVDAAQSPDVVFASILAAFSKARCK 235


>gi|52345486|ref|NP_001004791.1| adenylate kinase 2, mitochondrial [Xenopus (Silurana) tropicalis]
 gi|49522057|gb|AAH74526.1| adenylate kinase 2 [Xenopus (Silurana) tropicalis]
          Length = 235

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 114/216 (52%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LG ++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C  GF+LDG+PRTV QA+ L   +      +D+VIE +V+D+ +
Sbjct: 78  DEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++ A                    +  E  + RSDD       R+E Y     
Sbjct: 138 VRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTS 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY+  G    +D     D V  SI +     R
Sbjct: 198 PLVEYYQRHGIHTAVDAAQSPDVVFASILAAFSKAR 233


>gi|66556661|ref|XP_623921.1| PREDICTED: adenylate kinase 2, mitochondrial [Apis mellifera]
          Length = 252

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 111/215 (51%), Gaps = 21/215 (9%)

Query: 4   IFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAI 63
           + LGPPGSGKGTQA  L ++  V  LSTGDMLRAE++  + LG ++K  ++ G L+SD +
Sbjct: 27  VLLGPPGSGKGTQAPLLKERYCVCHLSTGDMLRAEINSGSALGAEIKKIIDEGKLVSDDL 86

Query: 64  VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKR 123
           V  ++   +  P+C  GF+LDG+PR+V QA+ L   +      +DAVIE  ++D  + KR
Sbjct: 87  VVNMIDHNLNKPECKRGFLLDGFPRSVPQAEKLDQMLKKRQTKLDAVIEFGIDDNLLIKR 146

Query: 124 IQVRVL---------EAIASEKSV------------RSDDKYDVFLKRIENYRKTILPLS 162
           I  R++         E  A  K              RSDD  +   KR+  Y     PL 
Sbjct: 147 ITGRLIHPTSGRSYHEEFAPPKEYMKDDITGEPLIRRSDDNVEALKKRLCTYHTETEPLI 206

Query: 163 SYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKK 197
            YY   G  Y ++      +V + ID + +   K+
Sbjct: 207 DYYALQGIHYYVNAARSSKDVFKDIDCIFLKATKQ 241


>gi|15598882|ref|NP_252376.1| adenylate kinase [Pseudomonas aeruginosa PAO1]
 gi|107103200|ref|ZP_01367118.1| hypothetical protein PaerPA_01004269 [Pseudomonas aeruginosa PACS2]
 gi|116051683|ref|YP_789478.1| adenylate kinase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890037|ref|YP_002438901.1| adenylate kinase [Pseudomonas aeruginosa LESB58]
 gi|254236597|ref|ZP_04929920.1| adenylate kinase [Pseudomonas aeruginosa C3719]
 gi|254242382|ref|ZP_04935704.1| adenylate kinase [Pseudomonas aeruginosa 2192]
 gi|296387807|ref|ZP_06877282.1| adenylate kinase [Pseudomonas aeruginosa PAb1]
 gi|313109092|ref|ZP_07795064.1| adenylate kinase [Pseudomonas aeruginosa 39016]
 gi|17366079|sp|Q9HXV4|KAD_PSEAE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|122260826|sp|Q02RF8|KAD_PSEAB RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|226722885|sp|B7V109|KAD_PSEA8 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|9949850|gb|AAG07074.1|AE004788_4 adenylate kinase [Pseudomonas aeruginosa PAO1]
 gi|115586904|gb|ABJ12919.1| adenylate kinase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168528|gb|EAZ54039.1| adenylate kinase [Pseudomonas aeruginosa C3719]
 gi|126195760|gb|EAZ59823.1| adenylate kinase [Pseudomonas aeruginosa 2192]
 gi|218770260|emb|CAW26025.1| adenylate kinase [Pseudomonas aeruginosa LESB58]
 gi|310881566|gb|EFQ40160.1| adenylate kinase [Pseudomonas aeruginosa 39016]
          Length = 215

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 117/218 (53%), Gaps = 31/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  +++K  +PQ+STGDMLRA V   + LG+QVKG M+SG L+S
Sbjct: 1   MRVILLGAPGAGKGTQARFITEKFGIPQISTGDMLRAAVKAGSPLGQQVKGVMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI   DC  GF+ DG+PRT+ QA++L     +    ID V+E+ V+D  +
Sbjct: 61  DDIIIALIKERITEADCAKGFLFDGFPRTIPQAEAL----KDAGVTIDHVVEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------IASEKSV-------RSDDKYDVFLKRIENYRKTIL 159
             RI  R +                +A +  V       R DDK +    R+  Y     
Sbjct: 117 VSRIAGRRVHPASGRVYHTEHNPPKVAGKDDVTGEELIQREDDKEETVRHRLSVYHSQTK 176

Query: 160 PLSSYYRDMGC------LYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+ +         + I G+  +++++  + S L
Sbjct: 177 PLVDFYQKLSAAEGTPKYHSIAGVGSVEQITAKVLSAL 214


>gi|295659148|ref|XP_002790133.1| adenylate kinase cytosolic [Paracoccidioides brasiliensis Pb01]
 gi|226282035|gb|EEH37601.1| adenylate kinase cytosolic [Paracoccidioides brasiliensis Pb01]
          Length = 276

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 113/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA  + +K  V  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPNIKEKFCVCHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     DC +GFILDG+PRTV QA+ L   + +    +   IEL+++DA 
Sbjct: 106 DEIMVNMIKHELETNKDCQNGFILDGFPRTVAQAERLDGMLDSRGQRLQHAIELQIDDAL 165

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR++ Y   
Sbjct: 166 LVARITGRLVHP-ASGRSYHKIFNPPKEPMKDDITGEPLIQRSDDNAEALQKRLKTYHSQ 224

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 225 TAPIVGYYKKTGIWTGIDASQEPGQVWKSL 254


>gi|328871011|gb|EGG19383.1| adenylate kinase [Dictyostelium fasciculatum]
          Length = 277

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 23/215 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +RI+ +GPPGSGKGTQA  + +  +V  LSTGD+LRA +++ T LGKQ K  ++ G L+ 
Sbjct: 29  LRIVLIGPPGSGKGTQAPIIKEDYSVCHLSTGDLLRAAIEQGTELGKQAKVIIDQGGLVP 88

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  +  ++ + ++ P+C  GFILDG+PRTV QA+ L   + +    ID V +  ++D+ +
Sbjct: 89  DETMIGMIKENLQNPECGKGFILDGFPRTVGQAEKLDKMLDDQGQKIDHVFDFFIDDSLL 148

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +RI  R++  +AS +S                       RSDD   V  KR+ ++    
Sbjct: 149 VRRITGRLVH-LASGRSYHREFFPPKVDMIDDVTGEPLIQRSDDNPAVLQKRLASFHSNT 207

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+ SYY++   L +ID       VS  I S+  +
Sbjct: 208 KPVLSYYKEKNILSVIDASRSATHVSNHIKSIFFN 242


>gi|242243968|ref|ZP_04798411.1| adenylate kinase [Staphylococcus epidermidis W23144]
 gi|242232601|gb|EES34913.1| adenylate kinase [Staphylococcus epidermidis W23144]
 gi|319400604|gb|EFV88829.1| adenylate kinase [Staphylococcus epidermidis FRI909]
          Length = 215

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +G PG+GKGTQA  + +K  +P +STGDM R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKDETDLGKEAKSYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +RI   D   GF+LDG+PRT+DQA+SL   +S +D  IDAVI + V +  +
Sbjct: 61  DEVTVGIVKERISEDDAKKGFLLDGFPRTIDQAESLSQIMSELDREIDAVINIEVPEEEL 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   R+ E   +   +                    R DD  +    R+    K   
Sbjct: 121 MNRLTGRRICEKCGTTYHLVFNPPKVDGICDIDGGKLYQREDDNPETVSNRLSVNVKQSK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           P+  YY + G L  IDG  D+DEV++ +  +L
Sbjct: 181 PILEYYNNKGVLKNIDGSKDIDEVTKDVIDIL 212


>gi|282857342|ref|ZP_06266579.1| adenylate kinase [Pyramidobacter piscolens W5455]
 gi|282584842|gb|EFB90173.1| adenylate kinase [Pyramidobacter piscolens W5455]
          Length = 216

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII +GPPG+GKGTQA ++  K  V  +STGD+LRA V   T LG++ K  M++G+L+ 
Sbjct: 1   MRIILVGPPGAGKGTQAEKIVAKYGVAHISTGDILRANVKAGTELGRKAKSFMDAGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  R+   DC  GFILDG+PRTV QA++L + ++ M+  +D VI L V+D ++
Sbjct: 61  DEVIVGMMRGRLAEDDCRKGFILDGFPRTVPQAEALTSLLAEMEIKLDGVILLDVDDETV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R +                     ++   +   R DD+  V  +R+  Y     
Sbjct: 121 VKRLCGRRMCKKCGRIYHVAFKPSSRGDHCDSCGGDLYQRDDDRETVIRQRLAVYHDQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  ID     D V   I+++L
Sbjct: 181 PLVDYYDKAGLLLRIDAAEAGDHVLSRIEAML 212


>gi|119476415|ref|ZP_01616766.1| adenylate kinase [marine gamma proteobacterium HTCC2143]
 gi|119450279|gb|EAW31514.1| adenylate kinase [marine gamma proteobacterium HTCC2143]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 105/189 (55%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR I LGPPG+GKGTQA  +S+   +PQ+STGDMLRA V   T +G +VK  M++G L+S
Sbjct: 1   MRAILLGPPGAGKGTQAQFISENYGIPQISTGDMLRAAVKAETEMGLKVKAVMDAGDLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI  PDC SGF+ DG+PRT+ QA++L A        ID V+E+ V+D  +
Sbjct: 61  DDIIIGIVKERITEPDCASGFLFDGFPRTIPQAEALQA----AGVEIDMVLEISVDDEEI 116

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   R+ EA      V                    R DDK D    R++ Y     
Sbjct: 117 VTRMSGRRIHEASGRVYHVVFNPPKKSGVDDETGDQLLQREDDKEDTVRTRLKVYHDQTK 176

Query: 160 PLSSYYRDM 168
           PL ++Y+ +
Sbjct: 177 PLVAFYQTL 185


>gi|119718104|ref|YP_925069.1| adenylate kinase [Nocardioides sp. JS614]
 gi|166980341|sp|A1SNJ7|KAD_NOCSJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|119538765|gb|ABL83382.1| Adenylate kinase [Nocardioides sp. JS614]
          Length = 191

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 108/187 (57%), Gaps = 6/187 (3%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA  +++   +P +STGD+ RA V   T LG + K  M++G  + 
Sbjct: 1   MRLIIMGPPGAGKGTQAKYIAEHFKIPAISTGDIFRANVTEGTPLGVEAKRYMDAGEYVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N++V +RI  PD   GF+LDGYPRTV Q + L   I      +DAV+ L V+   +
Sbjct: 61  DEVTNRMVRNRIDEPDAVGGFLLDGYPRTVAQVEELDGMIRFTGHRLDAVVCLTVDQDEI 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R      ++   R+DD  DV  +R + Y +   PL   Y+    ++ +DG+ ++
Sbjct: 121 VGRLLQR------AQVEGRADDTEDVIRRRQDLYLEQTAPLIEIYKQRDLVHEVDGIGEV 174

Query: 181 DEVSRSI 187
           DEV+  I
Sbjct: 175 DEVTARI 181


>gi|291616587|ref|YP_003519329.1| Adk [Pantoea ananatis LMG 20103]
 gi|291151617|gb|ADD76201.1| Adk [Pantoea ananatis LMG 20103]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 112/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LG Q K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGNQAKAIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQEDCKNGFLLDGFPRTIPQADAM----KEAGIKVDHVLEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VERIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQLTA 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY           + IDG  ++ +VS  +  +L
Sbjct: 177 PLIAYYSKEAEAGHTAYHKIDGTRNVSDVSAELAKIL 213


>gi|119383533|ref|YP_914589.1| adenylate kinase [Paracoccus denitrificans PD1222]
 gi|2851511|sp|P10772|KAD_PARDE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166219992|sp|A1B049|KAD_PARDP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|1498049|gb|AAB06328.1| adenylate kinase [Paracoccus denitrificans]
 gi|119373300|gb|ABL68893.1| Adenylate kinase [Paracoccus denitrificans PD1222]
          Length = 218

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 117/213 (54%), Gaps = 24/213 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + II LGPPG+GKGTQA RL  +  + QLSTGDMLR      T +GK+V   M+ G L++
Sbjct: 3   INIILLGPPGAGKGTQARRLIDERGLVQLSTGDMLREARSSGTEMGKRVAEVMDRGELVT 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++  R +L     GFI DG+PRT+ QA +L A ++ MD  IDAVIE+RV+DA++
Sbjct: 63  DEIVIGLI--REKLGQGGKGFIFDGFPRTLAQADALQALMAEMDQRIDAVIEMRVDDAAL 120

Query: 121 FKRIQVR--------VLEAI--------------ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R        V   +              +++   R+DD  +    R+  Y K  
Sbjct: 121 VSRISGRFTCGNCGEVYHDVTKPTKEPGKCDVCGSTDLRRRADDNEESLKTRLMEYYKKT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  +DG+ ++DEV+  +  ++
Sbjct: 181 SPLIGYYYVKGNLNPVDGLAEIDEVAAQVAKVM 213


>gi|21672734|ref|NP_660801.1| adenylate kinase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25008670|sp|Q8K980|KAD_BUCAP RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|21623379|gb|AAM68012.1| adenylate kinase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 214

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 119/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  +++  N+P++STGD+LR  + +   +GK++   +++G L+S
Sbjct: 1   MRIILLGAPGTGKGTQAKLITENYNIPKISTGDILRENIQKKNTIGKKIHNILKNGELVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           + IV  ++ +RI+  DC  GF+LDG+PRT  QA+    +ISN+   ID V+EL V    +
Sbjct: 61  NRIVCNLIGERIQKKDCIHGFLLDGFPRTQKQAE----YISNLKIKIDYVLELIVPYELI 116

Query: 121 FKRIQVRVLEA--------------------IASEK-SVRSDDKYDVFLKRIENYRKTIL 159
            KRI  R +                      +  EK ++R DD  ++  KR+ENY K   
Sbjct: 117 LKRICGRRVHTPSGRIYNINYNPPREEGKDDLTQEKLTIREDDTIEIVKKRLENYEKNSF 176

Query: 160 PLSSYYRDMGCL-----YIIDGMLDMDEVSRSIDSLL 191
            L+ YY     L     + IDG   + ++ R I  +L
Sbjct: 177 LLNKYYLREKKLKKLQYFKIDGKQSIYKIQREIKMML 213


>gi|50955546|ref|YP_062834.1| adenylate kinase [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|68568766|sp|Q6AD15|KAD_LEIXX RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|50952028|gb|AAT89729.1| adenylate kinase [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 199

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 106/185 (57%), Gaps = 6/185 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ +GPPG+GKGTQA R++    +P +STGD+ RA +   T LG+QVK  +++G  + D+
Sbjct: 1   MLIVGPPGAGKGTQASRITSGYGIPDISTGDIFRANIKNKTELGQQVKAIVDAGDYVPDS 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N++V  R+   D   GF+LDGYPRT++Q K L   + +    +DAVI+L  +   +  
Sbjct: 61  LTNELVTGRLAEDDAKGGFLLDGYPRTLEQVKYLDELLGSDGEKLDAVIQLVADREEIVA 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R  E        R+DD  +    R E Y +   PL   YR+ G L  +DG+  +DE
Sbjct: 121 RLTKRARE------QGRADDSEEAIRYRQEVYVRETSPLIEVYRERGLLVEVDGLGPVDE 174

Query: 183 VSRSI 187
           V+  I
Sbjct: 175 VAGRI 179


>gi|93006563|ref|YP_581000.1| adenylate kinases [Psychrobacter cryohalolentis K5]
 gi|92394241|gb|ABE75516.1| Adenylate kinase [Psychrobacter cryohalolentis K5]
          Length = 218

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 116/219 (52%), Gaps = 32/219 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++ ++PQ+STGDMLRA +   T LGKQ K  M +G L+S
Sbjct: 2   MRIILLGPPGAGKGTQAQFISKEYDIPQISTGDMLRAAIKEGTELGKQAKDVMNAGGLVS 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +RI  PDC +G ILDG+PRT+ QA++L    ++ +  ID VIE+ V D  +
Sbjct: 62  DDLIINLVQERIAKPDCVNGCILDGFPRTIPQAQAL----ADANVTIDHVIEISVPDDEI 117

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            KR+  R   A                    +  E  + R DDK      R+  Y +   
Sbjct: 118 VKRLSGRRQHAGSGRVYHIDHNPPKQEGIDDVTGEALIQREDDKESTIRDRLATYHEQTS 177

Query: 160 PLSSYYR-------DMGCLYIIDGMLDMDEVSRSIDSLL 191
            L  +Y+       D       DG   +D+V + I S L
Sbjct: 178 ALVGFYQNKAKEGGDAPKYDKFDGTQGIDDVKQQIFSAL 216


>gi|257866550|ref|ZP_05646203.1| adenylate kinase [Enterococcus casseliflavus EC30]
 gi|257872935|ref|ZP_05652588.1| adenylate kinase [Enterococcus casseliflavus EC10]
 gi|257876154|ref|ZP_05655807.1| adenylate kinase [Enterococcus casseliflavus EC20]
 gi|325567355|ref|ZP_08144022.1| adenylate kinase [Enterococcus casseliflavus ATCC 12755]
 gi|257800508|gb|EEV29536.1| adenylate kinase [Enterococcus casseliflavus EC30]
 gi|257807099|gb|EEV35921.1| adenylate kinase [Enterococcus casseliflavus EC10]
 gi|257810320|gb|EEV39140.1| adenylate kinase [Enterococcus casseliflavus EC20]
 gi|325158788|gb|EGC70934.1| adenylate kinase [Enterococcus casseliflavus ATCC 12755]
          Length = 214

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 116/213 (54%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M  I +G PG+GKGTQA R+  +  +P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNFILMGLPGAGKGTQAERIVAEYGLPHISTGDMFRAAMANETELGLKAKSYMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D + N +V +R+  PD + GF+LDG+PRT+DQAK+L   +++++  +DAVI++ V +  +
Sbjct: 61  DEVTNGIVKERLAEPDTEKGFLLDGFPRTLDQAKALDEMLADLNKKLDAVIDIHVPEEVL 120

Query: 121 FKRIQVRV-----------LEAIASEKSV-----------RSDDKYDVFLKRIENYRKTI 158
            +R+  R            L     E+             R DDK +    R+    K+ 
Sbjct: 121 VERLAGRFMCRNCGATYHKLFNPPKEEGTCDRCGSHDFYQREDDKPETVKNRLAVNIKSS 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+ +YY+D G L  IDG  D+D V   +  ++
Sbjct: 181 EPILTYYKDKGLLQSIDGDRDIDAVFEDVQKII 213


>gi|152983663|ref|YP_001346836.1| adenylate kinase [Pseudomonas aeruginosa PA7]
 gi|166980351|sp|A6V1A1|KAD_PSEA7 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|150958821|gb|ABR80846.1| adenylate kinase [Pseudomonas aeruginosa PA7]
          Length = 215

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (55%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  +++K  +PQ+STGDMLRA V   + LG+QVKG M+SG L+S
Sbjct: 1   MRVILLGAPGAGKGTQARFITEKFGIPQISTGDMLRAAVKAGSPLGQQVKGVMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI   DC  GF+ DG+PRT+ QA++L     +    ID V+E+ V+D  +
Sbjct: 61  DDIIIALIKERITEADCAKGFLFDGFPRTIPQAEAL----KDAGVTIDHVVEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------IASEKSV-------RSDDKYDVFLKRIENYRKTIL 159
             RI  R +                +A +  V       R DDK +    R+  Y     
Sbjct: 117 VSRIAGRRVHPASGRVYHTEHNPPKVAGKDDVTGEDLIQREDDKEETVRHRLSVYHSQTK 176

Query: 160 PLSSYYRDM 168
           PL  +Y+ +
Sbjct: 177 PLVDFYQKL 185


>gi|169335650|ref|ZP_02862843.1| hypothetical protein ANASTE_02070 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258388|gb|EDS72354.1| hypothetical protein ANASTE_02070 [Anaerofustis stercorihominis DSM
           17244]
          Length = 215

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+++ LGPPG+GKGTQA R+  K NV  +STGD+ R  +  NT LGK+ K  M+ G L+ 
Sbjct: 1   MKLVLLGPPGAGKGTQASRIVDKYNVVHISTGDIFRKNLSENTPLGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V DR+  PD   G++LDG+PRT+ QA+SL   +      +D  + +  + + +
Sbjct: 61  DDVTVEMVEDRLSWPDITDGYMLDGFPRTISQAESLDKILDKAGDKLDLALCIEADYSLL 120

Query: 121 FKRIQVR--------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILP 160
            KRI  R                    + +    E   R DDK D  +KR++ Y +   P
Sbjct: 121 TKRITGRRMCKCGETYHVEFHPPKVEGICDKCGGELYQRDDDKEDTVVKRLKEYEEKTQP 180

Query: 161 LSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           L  YY     L  ++G   +DEV   I  +L
Sbjct: 181 LVDYYEKQNILKTVNGSRTVDEVFEDISKIL 211


>gi|119496289|ref|XP_001264918.1| adenylate kinase, putative [Neosartorya fischeri NRRL 181]
 gi|224493003|sp|A1D3M8|KAD1_NEOFI RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|119413080|gb|EAW23021.1| adenylate kinase, putative [Neosartorya fischeri NRRL 181]
          Length = 257

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 112/210 (53%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ +GPPG+GKGTQA RL +K  V  L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 43  MRIVLMGPPGAGKGTQAPRLKEKYCVCHLATGDMLRSQVAKKTELGKEAKKIMDQGGLVS 102

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   +      +   IEL+++DA 
Sbjct: 103 DEIMVNMIKNELDTNTECKNGFILDGFPRTVAQAERLDDMLEARKQKLQHAIELQIDDAL 162

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR+  Y   
Sbjct: 163 LVARITGRLVHP-ASGRSYHKIFNPPKNDMKDDVTGEPLIQRSDDNAETLKKRLSTYHAQ 221

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 222 TAPVVEYYKKTGIWRGIDASQEPGQVWKSL 251


>gi|78185541|ref|YP_377975.1| adenylate kinase [Synechococcus sp. CC9902]
 gi|123581062|sp|Q3AW74|KAD_SYNS9 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|78169835|gb|ABB26932.1| Adenylate kinase [Synechococcus sp. CC9902]
          Length = 183

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/186 (37%), Positives = 110/186 (59%), Gaps = 11/186 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA R+     +  LSTGD+LR+EV   + LGK+ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARICDSNGMKHLSTGDLLRSEVAAGSELGKEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V  +++    + G++LDG+PRTV QA++L   ++ +   I+AV+ L ++DA + 
Sbjct: 64  QLVLAIVESQMKALSGE-GWLLDGFPRTVPQAEALEPLLNELKQPIEAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R           R+DD  DV   R+E YR    PL SYY++ G L  +     ++
Sbjct: 123 TRMLSR----------GRADDNEDVIRNRLEVYRDKTAPLISYYQNKGLLISVPAQGSVE 172

Query: 182 EVSRSI 187
           E++  I
Sbjct: 173 EITERI 178


>gi|331268434|ref|YP_004394926.1| nucleoside-triphosphate--adenylate kinase [Clostridium botulinum
           BKT015925]
 gi|329124984|gb|AEB74929.1| Nucleoside-triphosphate--adenylate kinase [Clostridium botulinum
           BKT015925]
          Length = 216

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 113/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ R  +   T LG + K  M+ G L+ 
Sbjct: 1   MRMILLGPPGAGKGTQAKLISEKYSIPHISTGDIFRKNISEKTPLGIKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC +GF+LDG+PRTV QA++L  F++  + ++D  + + V  + +
Sbjct: 61  DELTIDLVNDRLTHEDCKTGFLLDGFPRTVKQAEALENFLNKNNQSLDTALLVNVPSSFI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +   +E   R DD  +   +RIE Y +   
Sbjct: 121 LERMTGRRVCPSCGASYHIKFNPPKIEGLCDVCKAEVIQRKDDTEETVKERIEVYDRQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     L+++DG   +D+V  +I
Sbjct: 181 PLVDFYASKDQLFVVDGTQSIDQVFETI 208


>gi|262203554|ref|YP_003274762.1| adenylate kinase [Gordonia bronchialis DSM 43247]
 gi|262086901|gb|ACY22869.1| adenylate kinase [Gordonia bronchialis DSM 43247]
          Length = 184

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 111/191 (58%), Gaps = 12/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS+ L +P +STGD+ RA + + T +G + K  +++G+L+ 
Sbjct: 1   MRLVILGPPGAGKGTQAELLSEALGIPHISTGDLFRANISQGTAVGVEAKKYLDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             I   +V  R+  PD   GFILDG+PR+ +QA +L   ++++D ++DAV+   V+   +
Sbjct: 61  SEITVDMVRARVGEPDAAKGFILDGFPRSTEQADALKEILASLDSSLDAVLSFEVDTDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R           R+DD  +V   R+  Y K   PL +YY D   +  ID + D+
Sbjct: 121 VDRMLAR----------GRADDTEEVIRNRMAVYTKETAPLLAYYGDQ--VKTIDAVGDI 168

Query: 181 DEVSRSIDSLL 191
            +V + + S L
Sbjct: 169 QDVHQRVLSAL 179


>gi|284006441|emb|CBA71689.1| adenylate kinase [Arsenophonus nasoniae]
          Length = 214

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 113/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + ++  +PQ+STGDMLRA V   T LG++ K  M+SG L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMERYGIPQISTGDMLRAAVKAGTELGRKAKELMDSGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V  RI   DC +GF+LDG+PRT+ QA ++     N    +D V+E  V D  +
Sbjct: 61  DELVIALVKQRIAQDDCRNGFLLDGFPRTIPQADAM----KNAGITVDYVLEFDVPDEII 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                          E S+R DD+ +   KR+  Y +   
Sbjct: 117 VERIVGRRVHTASGRVYHIKFNPPKIANRDDVTGEELSIRKDDQEETVRKRLVEYHQLTE 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL +YYR          + +DG   + EVS  +  +L
Sbjct: 177 PLIAYYRQEAAAAHTKYFKLDGSRKVTEVSEELAKIL 213


>gi|220917142|ref|YP_002492446.1| Adenylate kinase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254806966|sp|B8J881|KAD_ANAD2 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|219954996|gb|ACL65380.1| Adenylate kinase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 214

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 108/198 (54%), Gaps = 21/198 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA  LS +L +P +STGDM R    R T +GKQV+  M++G L++
Sbjct: 1   MILILLGPPGAGKGTQAKLLSSELGIPHISTGDMFRDHKARGTEIGKQVQAIMDAGGLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V +R+  PD   GFILDGYPRTV QA+ L   + ++  +ID  +   V +  +
Sbjct: 61  DDITNAMVKERLSRPDVAPGFILDGYPRTVVQAEYLDGLLRSLGRSIDRALSYEVPEELV 120

Query: 121 FKRIQVR-------VLEAIASEKSVRS--------------DDKYDVFLKRIENYRKTIL 159
            +RI  R        +  ++     R+              DDK +   KR++ Y     
Sbjct: 121 VERISGRRSCPRCGAVYHVSQNPPHRAGFCDRDDAALVQREDDKPENVRKRMQEYGTKTE 180

Query: 160 PLSSYYRDMGCLYIIDGM 177
           PL  YYRD G L  ++G+
Sbjct: 181 PLKRYYRDRGELSDVEGV 198


>gi|49089162|gb|AAT51650.1| PA3686 [synthetic construct]
          Length = 216

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 117/218 (53%), Gaps = 31/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  +++K  +PQ+STGDMLRA V   + LG+QVKG M+SG L+S
Sbjct: 1   MRVILLGAPGAGKGTQARFITEKFGIPQISTGDMLRAAVKAGSPLGQQVKGVMDSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI   DC  GF+ DG+PRT+ QA++L     +    ID V+E+ V+D  +
Sbjct: 61  DDIIIALIEERITEADCAKGFLFDGFPRTIPQAEAL----KDAGVTIDHVVEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------IASEKSV-------RSDDKYDVFLKRIENYRKTIL 159
             RI  R +                +A +  V       R DDK +    R+  Y     
Sbjct: 117 VSRIAGRRVHPASGRVYHTEHNPPKVAGKDDVTGEELIQREDDKEETVRHRLSVYHSQTK 176

Query: 160 PLSSYYRDMGC------LYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+ +         + I G+  +++++  + S L
Sbjct: 177 PLVDFYQKLSAAEGTPKYHSIAGVGSVEQITAKVLSAL 214


>gi|300715634|ref|YP_003740437.1| Adenylate kinase (ATP-AMP transphosphorylase) [Erwinia billingiae
           Eb661]
 gi|299061470|emb|CAX58584.1| Adenylate kinase (ATP-AMP transphosphorylase) [Erwinia billingiae
           Eb661]
          Length = 214

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 113/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LGKQ K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGKQAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     +    +D V+E  V D  +
Sbjct: 61  DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAM----KDAGIKVDNVLEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VERIVGRRVHAPSGRVYHVNFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTA 176

Query: 160 PLSSYY-----RDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY           + IDG   + EVS  +  +L
Sbjct: 177 PLIAYYSKEAAEGHTAYHKIDGTRKVSEVSAELAKIL 213


>gi|320529817|ref|ZP_08030894.1| adenylate kinase [Selenomonas artemidis F0399]
 gi|320137835|gb|EFW29740.1| adenylate kinase [Selenomonas artemidis F0399]
          Length = 214

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 106/212 (50%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L ++  +  +STGDM R  V   T LGK+ K  M++G L+ 
Sbjct: 1   MHIILMGPPGAGKGTQATNLVKRYGILHISTGDMFREAVKEGTPLGKEAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V +R+  PDC  GFILDG+PRTV+QA +L   + +    + AV+ + V    +
Sbjct: 61  DSVTIGIVRERLSKPDCRKGFILDGFPRTVEQADALGEILKDNGLQLTAVLNINVPTEDL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     V +    E   R+DD  D    R+  Y  +  
Sbjct: 121 IERAVGRRICKSCGHSFHVKFNPTKVEGVCDDCGGETYQRADDSADTMKSRLSVYESSTR 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR  G    IDG  D+ +V   + + L
Sbjct: 181 PLIEYYRKAGVYKEIDGRQDIAKVEADLSAAL 212


>gi|255305036|ref|ZP_05349208.1| adenylate kinase [Clostridium difficile ATCC 43255]
          Length = 216

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 108/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 61  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 121 VSRAVGRRICKSCGATYHVEFNPPKIEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY   G +  I G   +D+V   I + L S
Sbjct: 181 PLVDYYSKQGIIADIKGDQAIDKVFEDIVAALGS 214


>gi|260681867|ref|YP_003213152.1| adenylate kinase [Clostridium difficile CD196]
 gi|260685465|ref|YP_003216598.1| adenylate kinase [Clostridium difficile R20291]
 gi|260208030|emb|CBA60225.1| adenylate kinase [Clostridium difficile CD196]
 gi|260211481|emb|CBE01615.1| adenylate kinase [Clostridium difficile R20291]
          Length = 221

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 108/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 6   MRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 65

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 66  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 125

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 126 VSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 185

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY   G +  I G   +D+V   I + L S
Sbjct: 186 PLVDYYSKQGIIADIKGDQAIDKVFEDIVAALGS 219


>gi|281211724|gb|EFA85886.1| adenylate kinase [Polysphondylium pallidum PN500]
          Length = 275

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 112/213 (52%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +RI+F+GPPGSGKGTQA  +  +  V  LSTGD+LRA ++  T  GK+ K  M+ G L+ 
Sbjct: 32  LRIVFIGPPGSGKGTQAPIIKDEYCVCHLSTGDILRAAIEAGTDAGKKAKVVMDQGGLVP 91

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ D +  P C +GFILDG+PRTV QA+ L A +      ID V++  ++D+ +
Sbjct: 92  DDLVVDMIKDNLEKPACANGFILDGFPRTVVQAEKLDAMLEQDKKKIDHVLDFSIDDSLL 151

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
            +RI  R++   AS +S                       RSDD   V  KR+  +    
Sbjct: 152 VRRITGRLVHP-ASGRSYHKEFFPPKEEMKDDITGEPLIQRSDDNEAVLTKRLATFHANT 210

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            P+ SYY+  G L  ID       VS  I ++ 
Sbjct: 211 TPVLSYYKKQGILSTIDASKSASFVSNHIKAIF 243


>gi|16272300|ref|NP_438513.1| adenylate kinase [Haemophilus influenzae Rd KW20]
 gi|68248954|ref|YP_248066.1| adenylate kinase [Haemophilus influenzae 86-028NP]
 gi|145628705|ref|ZP_01784505.1| adenylate kinase [Haemophilus influenzae 22.1-21]
 gi|145636382|ref|ZP_01792051.1| adenylate kinase [Haemophilus influenzae PittHH]
 gi|145638740|ref|ZP_01794349.1| adenylate kinase [Haemophilus influenzae PittII]
 gi|148827494|ref|YP_001292247.1| adenylate kinase [Haemophilus influenzae PittGG]
 gi|229844560|ref|ZP_04464700.1| adenylate kinase [Haemophilus influenzae 6P18H1]
 gi|260581185|ref|ZP_05849004.1| adenylate kinase [Haemophilus influenzae RdAW]
 gi|319775781|ref|YP_004138269.1| adenylate kinase [Haemophilus influenzae F3047]
 gi|329123623|ref|ZP_08252183.1| adenylate kinase [Haemophilus aegyptius ATCC 11116]
 gi|1170608|sp|P24323|KAD_HAEIN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|81336634|sp|Q4QNJ1|KAD_HAEI8 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|166980325|sp|A5UGF8|KAD_HAEIG RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|1573319|gb|AAC22010.1| adenylate kinase (adk) [Haemophilus influenzae Rd KW20]
 gi|68057153|gb|AAX87406.1| adenylate kinase [Haemophilus influenzae 86-028NP]
 gi|144979175|gb|EDJ88861.1| adenylate kinase [Haemophilus influenzae 22.1-21]
 gi|145270547|gb|EDK10481.1| adenylate kinase [Haemophilus influenzae PittHH]
 gi|145272335|gb|EDK12243.1| adenylate kinase [Haemophilus influenzae PittII]
 gi|148718736|gb|ABQ99863.1| hypothetical protein CGSHiGG_04555 [Haemophilus influenzae PittGG]
 gi|229812809|gb|EEP48498.1| adenylate kinase [Haemophilus influenzae 6P18H1]
 gi|260092110|gb|EEW76054.1| adenylate kinase [Haemophilus influenzae RdAW]
 gi|309750230|gb|ADO80214.1| Adenylate kinase [Haemophilus influenzae R2866]
 gi|317450372|emb|CBY86588.1| adenylate kinase [Haemophilus influenzae F3047]
 gi|327469822|gb|EGF15287.1| adenylate kinase [Haemophilus aegyptius ATCC 11116]
          Length = 214

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 114/218 (52%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRIAQADCTNGFLLDGFPRTIPQADAL----KDSGVKIDFVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R+  Y K  
Sbjct: 117 VERMSGRRVHQ-ASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQT 175

Query: 159 LPLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++EVS+ +D +L
Sbjct: 176 SPLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKIL 213


>gi|254973752|ref|ZP_05270224.1| adenylate kinase [Clostridium difficile QCD-66c26]
 gi|255091142|ref|ZP_05320620.1| adenylate kinase [Clostridium difficile CIP 107932]
 gi|255099253|ref|ZP_05328230.1| adenylate kinase [Clostridium difficile QCD-63q42]
 gi|255312796|ref|ZP_05354379.1| adenylate kinase [Clostridium difficile QCD-76w55]
 gi|255515555|ref|ZP_05383231.1| adenylate kinase [Clostridium difficile QCD-97b34]
 gi|255648650|ref|ZP_05395552.1| adenylate kinase [Clostridium difficile QCD-37x79]
 gi|306518772|ref|ZP_07405119.1| adenylate kinase [Clostridium difficile QCD-32g58]
          Length = 216

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 108/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 61  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 121 VSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY   G +  I G   +D+V   I + L S
Sbjct: 181 PLVDYYSKQGIIADIKGDQAIDKVFEDIVAALGS 214


>gi|126697661|ref|YP_001086558.1| adenylate kinase [Clostridium difficile 630]
 gi|123363702|sp|Q18CH9|KAD_CLOD6 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|115249098|emb|CAJ66909.1| Adenylate kinase [Clostridium difficile]
          Length = 216

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 108/214 (50%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  + +K N+P +STGD+ R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAVGIVEKYNIPHISTGDIFRKNIKEGTELGKKAKEYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PR V Q + L  F+ N   ++D V+ + V+ + +
Sbjct: 61  DELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIFLKNAGISLDKVVNIEVDKSIL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R   R                     V +    E   R+DD  +   KRI+ Y     
Sbjct: 121 VSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELYQRADDNEETVSKRIQVYLDETK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  YY   G +  I G   +D+V   I + L S
Sbjct: 181 PLVDYYSKQGIIADIKGDQAIDKVFEDIVAALGS 214


>gi|260655362|ref|ZP_05860850.1| adenylate kinase [Jonquetella anthropi E3_33 E1]
 gi|260629810|gb|EEX48004.1| adenylate kinase [Jonquetella anthropi E3_33 E1]
          Length = 216

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 108/208 (51%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA ++ ++ +   +STGD+LR  V   T LGK+ KG M+SG L+ 
Sbjct: 1   MRLILLGAPGAGKGTQAEKIVERWHTAHISTGDILRENVKGGTELGKKAKGYMDSGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  ++  R++ PDC SGFILDG+PRT  QA++L   +  M   +D V+ L V D  +
Sbjct: 61  DDLIVAMMEGRLKEPDCASGFILDGFPRTKGQAEALKELLGRMGLHLDGVVLLDVPDDVV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       E    E   R DDK  V  +R+  Y +   
Sbjct: 121 VQRLCGRRCCRGCGKIYNVSFKPSSKGDHCEVCGGELFQRDDDKEAVIRQRLSVYHEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G L   DG L  D +  +I
Sbjct: 181 PLVEYYEAEGLLCRFDGTLAGDGIINAI 208


>gi|291280128|ref|YP_003496963.1| adenylate kinase [Deferribacter desulfuricans SSM1]
 gi|290754830|dbj|BAI81207.1| adenylate kinase [Deferribacter desulfuricans SSM1]
          Length = 215

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 113/213 (53%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           + I+FLGPPG+GKGTQ+ +L +  N+ Q+STGD+LR  V   + LGK  K  M+ G L+ 
Sbjct: 2   INIVFLGPPGAGKGTQSAKLVEDFNIVQISTGDILRNAVKTGSELGKLAKKYMDEGKLVP 61

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISN-MDCAIDAVIELRVEDAS 119
           D ++  +V  R++  DC +GFILDG+PRT+ QA++L   + N ++  +  +I L V D  
Sbjct: 62  DDVIIGIVKARLQQDDCKNGFILDGFPRTIPQAEALDEMLKNDLNIELTHIISLNVPDEL 121

Query: 120 MFKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
           + +R+  R                       +   ++   R DDK +   KR++ Y +  
Sbjct: 122 ILERLTGRRSCPQCGAAYHIKYNPPKEDNKCDLCGADLIQRDDDKEETINKRLKVYHEQT 181

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             L  YY      Y IDG L+ DEV R I  LL
Sbjct: 182 EQLKEYYSKTNKFYEIDGTLNPDEVYRKIKELL 214


>gi|308185947|ref|YP_003930078.1| adenylate kinase [Pantoea vagans C9-1]
 gi|308056457|gb|ADO08629.1| adenylate kinase [Pantoea vagans C9-1]
          Length = 214

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 111/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG Q K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGNQAKAIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQEDCKNGFLLDGFPRTIPQADAM----KEAGITVDHVLEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VERIVGRRVHAPSGRVYHVTFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTA 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY           + IDG   + EVS  +  +L
Sbjct: 177 PLIAYYSKEAEAGNTAYHKIDGTRKVTEVSAELAKIL 213


>gi|238899127|ref|YP_002924809.1| adenylate kinase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259494007|sp|C4K7W8|KAD_HAMD5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|229466887|gb|ACQ68661.1| adenylate kinase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 216

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  + Q+STGDMLRA V   T LG+QV+G M +G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMKKYGIVQISTGDMLRAAVKAGTKLGQQVQGIMAAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RIR  DC  GF+LDG+PRT+ QA ++    +  D  ID V+EL V D  +
Sbjct: 61  DDLVIALVKERIRQEDCKEGFLLDGFPRTIPQADAM----AEADIKIDYVLELVVPDEFI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +      ++R DD+     +R+  Y +  +
Sbjct: 117 VERISGRRVHMPSGRIYHLKFNPPKITDKDDMTGESLTLRKDDQETTVRERLLEYHQQTM 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
            L  YYR          + +DG   ++EVS+ + S+L
Sbjct: 177 ALVDYYRQRAKRGDTKYFKLDGTRTVNEVSQQLSSIL 213


>gi|119713403|gb|ABL97465.1| adenylate kinase [uncultured marine bacterium HF130_81H07]
          Length = 214

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 105/188 (55%), Gaps = 27/188 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LGPPG+GKGTQA  +S KL +P +STGDMLR  +  NT LGK+ K  M+SG L+S
Sbjct: 1   MKIILLGPPGAGKGTQAEVISNKLKIPHISTGDMLRESIRNNTPLGKKAKKIMDSGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +R+   DC +GF+ DG+PRT+ QA  L     N++  ID VIE+ + D  +
Sbjct: 61  DEIILGIIKERVSKEDCKTGFLFDGFPRTIGQADGL----KNLNIDIDIVIEISLSDEVI 116

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             R+  R +  ++S +S                       R DDK    L R+E Y+   
Sbjct: 117 ISRMSGRRIH-LSSGRSYHIEFNPPRVEGKDDLSGEDLIQREDDKPMTVLARLEVYKNQT 175

Query: 159 LPLSSYYR 166
            PL  YY+
Sbjct: 176 DPLIDYYQ 183


>gi|293568358|ref|ZP_06679680.1| adenylate kinase [Enterococcus faecium E1071]
 gi|307287240|ref|ZP_07567308.1| putative adenylate kinase [Enterococcus faecalis TX0109]
 gi|291588928|gb|EFF20754.1| adenylate kinase [Enterococcus faecium E1071]
 gi|306501697|gb|EFM70989.1| putative adenylate kinase [Enterococcus faecalis TX0109]
          Length = 206

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 119/206 (57%), Gaps = 10/206 (4%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA R++++ ++  +STG+MLR         G +V+  M  G L+ 
Sbjct: 1   MRLVLLGLPGAGKGTQAKRIAEEYHLTAISTGEMLREATKEKDTFGLRVQEYMNKGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D  +N +   R++  D ++GF+LDGYPRT+ QAK L A++ + +  +DAV  L V   ++
Sbjct: 61  DEWINSLAKSRLQAKDVENGFVLDGYPRTLQQAKMLEAYLQSQNQNLDAVFFLDVSQDTL 120

Query: 121 FKRI----QVRVLE-----AIASEKS-VRSDDKYDVFLKRIENYRKTILPLSSYYRDMGC 170
             R+     +R  E      I S++  +R DDK +V   R+   ++ +  L  +Y++   
Sbjct: 121 RHRLAQRGNLRSKEKQGNSQIESKREKIRLDDKLEVIENRLHINKELMESLIHFYKERNL 180

Query: 171 LYIIDGMLDMDEVSRSIDSLLVSVRK 196
           LY+I+G  D D V  +I+  L+SV K
Sbjct: 181 LYVINGEGDFDNVFDNINEGLLSVNK 206


>gi|54294297|ref|YP_126712.1| adenylate kinase [Legionella pneumophila str. Lens]
 gi|81822393|sp|Q5WWT7|KAD_LEGPL RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|53754129|emb|CAH15602.1| adenylate kinase [Legionella pneumophila str. Lens]
          Length = 218

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 118/220 (53%), Gaps = 33/220 (15%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  L  +  +PQ+STGDMLRA + + T LG   +  MESG L+S
Sbjct: 1   MRLMLLGGPGAGKGTQASLLINRYKIPQISTGDMLRAAIAKGTPLGLSAQKIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R++ PDCD GF+ DG+PRT+ QA++L     + +  +D VIE+ V+D  +
Sbjct: 61  DDIIIGLVKERLKNPDCDRGFLFDGFPRTLVQAEAL----KDAEIHLDHVIEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                      I  E  + R DDK +   KR++ Y     
Sbjct: 117 IERISGRRIHQPSGRVYHVVNQPPKNPGVDDITGEPLIQRDDDKEETIRKRLQVYHSQTA 176

Query: 160 PLSSYYRDMG--------CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY++            + I G   +D++  +I ++L
Sbjct: 177 PLVQYYKEWAESGSKEAPKFHTISGTGTVDQIFDNIVTIL 216


>gi|121594650|ref|YP_986546.1| adenylate kinase [Acidovorax sp. JS42]
 gi|222110748|ref|YP_002553012.1| adenylate kinase [Acidovorax ebreus TPSY]
 gi|166980290|sp|A1W895|KAD_ACISJ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|254806987|sp|B9MI80|KAD_DIAST RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|120606730|gb|ABM42470.1| Adenylate kinase [Acidovorax sp. JS42]
 gi|221730192|gb|ACM33012.1| adenylate kinase [Acidovorax ebreus TPSY]
          Length = 218

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 17/182 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG Q K  M++G L+S
Sbjct: 1   MRLILLGAPGAGKGTQAAFICQKFGIPQISTGDMLRAAVKAGTPLGLQAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V +RI  PDC  GF+ DG+PRT+ QA ++ A      ++  +D   DA+IE  
Sbjct: 61  DDLIINLVKERIAEPDCAQGFLFDGFPRTIPQADAMKAAGVKLDYVLEIDVPFDAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   +V   + +  E  V R DDK +   KR++ Y     PL  
Sbjct: 121 SGRRSHPASGRTYHVKFNPPKVEGKDDVTGEPLVQREDDKEETVKKRLQVYSDQTRPLVD 180

Query: 164 YY 165
           YY
Sbjct: 181 YY 182


>gi|310796791|gb|EFQ32252.1| adenylate kinase [Glomerella graminicola M1.001]
          Length = 274

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 120/224 (53%), Gaps = 24/224 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++ +K N   L+TGDMLR++V + T LG++ K  M+ G L+S
Sbjct: 42  VRMILIGPPGAGKGTQAPKIKEKFNCCHLATGDMLRSQVAKKTPLGREAKKIMDQGGLVS 101

Query: 61  DAIVNQVVCDRIR-LPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D IV  ++ + +    +C  GFILDG+PRTV QA+ L A +   +  +   +EL+++D+ 
Sbjct: 102 DDIVIGMIKEELENNKECKGGFILDGFPRTVPQAEGLDAMLKARNQKLQHAVELQIDDSL 161

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  +   KR+  Y   
Sbjct: 162 LVARITGRLVHP-ASGRSYHSTFNPPKNYMKDDITGEPLIQRSDDNAEALKKRLATYHSQ 220

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRKKCSSS 201
             P+  YY+  G    +D   +  +V +++  +  S RK   +S
Sbjct: 221 TAPVVGYYKQTGIWKGLDASQEPGQVWKNMLDIFESQRKGGHAS 264


>gi|159039813|ref|YP_001539066.1| adenylate kinase [Salinispora arenicola CNS-205]
 gi|189028363|sp|A8M508|KAD_SALAI RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|157918648|gb|ABW00076.1| Adenylate kinase [Salinispora arenicola CNS-205]
          Length = 217

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 114/212 (53%), Gaps = 22/212 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  ++  L VP++STGD+ R+ V + T LG Q K  M++G L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAEFVAAHLAVPKISTGDIFRSNVSQGTPLGVQAKRYMDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+  PD   GF+LDG+PRT  QA +L   + ++  A+D V+EL V+D  +
Sbjct: 61  DEVTINMVRDRLAEPDASEGFLLDGFPRTTPQAAALDKLLVDLGTALDLVLELVVDDDEV 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +   +E   R DDK +    R+  Y     
Sbjct: 121 IRRLSGRRTCRGCGKVWHVEFDAPSQEGRCDRCGAELFQRDDDKPETVATRLREYADKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVS-RSIDSL 190
           PL  YY   G L  ID    +++V+ R+ID+L
Sbjct: 181 PLVDYYGAQGKLVGIDATGPVEDVTVRAIDAL 212


>gi|327297622|ref|XP_003233505.1| adenylate kinase [Trichophyton rubrum CBS 118892]
 gi|326464811|gb|EGD90264.1| adenylate kinase [Trichophyton rubrum CBS 118892]
          Length = 272

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 111/209 (53%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA ++ +K  V  LSTGDMLR++V R T LGK  K  M+ G L+S
Sbjct: 45  MRMILMGPPGAGKGTQAPKIKEKYCVCHLSTGDMLRSQVSRQTELGKAAKKIMDQGGLVS 104

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I+  ++ + +    +C  GFILDG+PRTV QA+ L   +     A+   +EL+++D+ 
Sbjct: 105 DEIMVGMIKNELESNKECKKGFILDGFPRTVAQAERLDDMLRERKQALQHAVELQIDDSL 164

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  +   KR+  Y    
Sbjct: 165 LVSRITGRLIHPGSGRSYHKIFNPPKKEMTDDITGEPLVQRSDDNAEALKKRLATYHAQT 224

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY+  G    ID   +  +V +SI
Sbjct: 225 APVVGYYKKTGIWSGIDASQEPGQVWKSI 253


>gi|237786348|ref|YP_002907053.1| adenylate kinase [Corynebacterium kroppenstedtii DSM 44385]
 gi|259493994|sp|C4LL05|KAD_CORK4 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|237759260|gb|ACR18510.1| adenylate kinase [Corynebacterium kroppenstedtii DSM 44385]
          Length = 184

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 97/167 (58%), Gaps = 10/167 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS KL VP +STGD+ R  +  NT LG++ K  +++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAAILSDKLGVPHVSTGDLFRENIGNNTELGQEAKSYIDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            ++   +V DR+   D   GF+LDG+PRTV+Q   L   +  +   +DAV++  V +  +
Sbjct: 61  TSVTVNMVKDRLSQDDAADGFLLDGFPRTVEQGDELKNILDGLGTKLDAVLQFDVSEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
            +R+  R           R+DD  +V   R++ YR    PL  YY+D
Sbjct: 121 VERMLAR----------GRADDTEEVIRTRLKVYRDETAPLLEYYKD 157


>gi|296141076|ref|YP_003648319.1| adenylate kinase [Tsukamurella paurometabola DSM 20162]
 gi|296029210|gb|ADG79980.1| adenylate kinase [Tsukamurella paurometabola DSM 20162]
          Length = 181

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 105/183 (57%), Gaps = 12/183 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA +LS+K  +P +STGD+ RA +   T LG + K  M+ G L+ 
Sbjct: 1   MRLVILGPPGAGKGTQAEKLSEKYGIPHISTGDLFRANISEGTELGVEAKKYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            ++   +V  R+  PD  +GFILDG+PR+ DQA SL   +   +  +DAVI   V + ++
Sbjct: 61  SSVTVDMVRSRLDEPDAVNGFILDGFPRSTDQADSLAEILVPRNEKLDAVISFEVPEDTV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  +V   R++ Y K   PL  YY D   +  ID +  +
Sbjct: 121 VERMLAR----------GRADDTEEVIRNRMQVYAKQTAPLLDYYGDF--VTHIDAVGTV 168

Query: 181 DEV 183
           DEV
Sbjct: 169 DEV 171


>gi|145640300|ref|ZP_01795884.1| adenylate kinase [Haemophilus influenzae R3021]
 gi|260582557|ref|ZP_05850347.1| adenylate kinase [Haemophilus influenzae NT127]
 gi|319896681|ref|YP_004134874.1| adenylate kinase [Haemophilus influenzae F3031]
 gi|43591|emb|CAA40570.1| adenylate kinase [Haemophilus influenzae]
 gi|145274886|gb|EDK14748.1| adenylate kinase [Haemophilus influenzae 22.4-21]
 gi|260094368|gb|EEW78266.1| adenylate kinase [Haemophilus influenzae NT127]
 gi|301169054|emb|CBW28651.1| adenylate kinase [Haemophilus influenzae 10810]
 gi|309972489|gb|ADO95690.1| Adenylate kinase [Haemophilus influenzae R2846]
 gi|317432183|emb|CBY80535.1| adenylate kinase [Haemophilus influenzae F3031]
          Length = 214

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 114/218 (52%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRIAQADCANGFLLDGFPRTIPQADAL----KDSGVKIDFVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS +S                      +R+DDK +  L R+  Y K  
Sbjct: 117 VERMSGRRVHQ-ASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQT 175

Query: 159 LPLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++EVS+ +D +L
Sbjct: 176 SPLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKIL 213


>gi|58261032|ref|XP_567926.1| adenylate kinase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134116815|ref|XP_772932.1| hypothetical protein CNBK0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|74682475|sp|Q5K931|KAD1_CRYNE RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|50255551|gb|EAL18285.1| hypothetical protein CNBK0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230007|gb|AAW46409.1| adenylate kinase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 269

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 112/217 (51%), Gaps = 24/217 (11%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA  +S K  +  L+TGDMLR +V R T LGK  K  M+ G L+SD
Sbjct: 53  RMVLIGPPGAGKGTQAPNISSKYCICHLATGDMLREQVARQTELGKAAKQIMDQGGLVSD 112

Query: 62  AIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            I+  ++   + +  +C +GFILDG+PRTV QA  L A ++    AID  IEL++ D  +
Sbjct: 113 EIMVGMIKQELEKNAECKNGFILDGFPRTVPQASKLDAMLAERKQAIDHAIELKIPDVLL 172

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             RI  R++   AS +S                       RSDD      KR++ Y    
Sbjct: 173 ISRITGRLVHP-ASGRSYHKEFNPPKKPMTDDITGEPLIQRSDDNVGTLRKRLDTYHAQT 231

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
            P+  YY+  G    +D       V  SI S+L S +
Sbjct: 232 GPVVDYYKGTGVWTPVDAAQSPKLVWASISSILESKK 268


>gi|326472245|gb|EGD96254.1| adenylate kinase [Trichophyton tonsurans CBS 112818]
 gi|326483300|gb|EGE07310.1| adenylate kinase [Trichophyton equinum CBS 127.97]
          Length = 272

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 111/209 (53%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA ++ +K  V  LSTGDMLR++V R T LGK  K  M+ G L+S
Sbjct: 45  MRMILMGPPGAGKGTQAPKIKEKYCVCHLSTGDMLRSQVSRQTELGKAAKKIMDQGGLVS 104

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I+  ++ + +    +C  GFILDG+PRTV QA+ L   +     A+   +EL+++D+ 
Sbjct: 105 DEIMVGMIKNELESNKECKKGFILDGFPRTVAQAERLDDMLRERKQALQHAVELQIDDSL 164

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  +   KR+  Y    
Sbjct: 165 LVSRITGRLIHPGSGRSYHKIFNPPKKEMTDDITGEPLVQRSDDNAEALKKRLATYHAQT 224

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY+  G    ID   +  +V +SI
Sbjct: 225 APVVGYYKKTGIWSGIDASQEPGQVWKSI 253


>gi|319779514|ref|YP_004130427.1| Adenylate kinase [Taylorella equigenitalis MCE9]
 gi|317109538|gb|ADU92284.1| Adenylate kinase [Taylorella equigenitalis MCE9]
          Length = 216

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 120/216 (55%), Gaps = 26/216 (12%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +  K N+PQ+STGDMLRA V   T LG QVK  MESG L+S
Sbjct: 1   MRLILLGPPGAGKGTQANFIKNKYNIPQISTGDMLRATVKAGTPLGLQVKSIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLH------AFISNMDCAIDAVIE-- 112
           D I+  +V +R++  DC  G++ DG+PRT+ QA++L        ++  +D   DA+IE  
Sbjct: 61  DDIIINLVKERLKEDDCKKGYLFDGFPRTIPQAEALKDAGVDLDYVIEIDVPHDAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   ++   +    E+ + R DDK +   KR++ Y     PL  
Sbjct: 121 SGRRTHPASGRTYHIKFNPPKIDGKDDETGEELIQRDDDKEETVRKRLDVYENQTRPLVD 180

Query: 164 YYRDM-------GCLYI-IDGMLDMDEVSRSI-DSL 190
           +Y             YI I+G+ D+D +S+ I DSL
Sbjct: 181 FYSKWAESGDSKAPKYIKINGVGDVDSISKLIVDSL 216


>gi|311107327|ref|YP_003980180.1| adenylate kinase [Achromobacter xylosoxidans A8]
 gi|310762016|gb|ADP17465.1| adenylate kinase [Achromobacter xylosoxidans A8]
          Length = 218

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 104/186 (55%), Gaps = 25/186 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  L+Q   +PQ+STGDMLRA V   T LG + K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAAFLTQHFGIPQISTGDMLRAAVKAGTPLGIEAKKVMDAGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DR++ PDC +G++ DG+PRT+ QA +L     +    +D V+E+ V +  +
Sbjct: 61  DEIIIGLVQDRLQQPDCANGYLFDGFPRTIPQADAL----KSAGVKLDYVVEIEVPEEDI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                      I  E+ + R DD+ D    R+  YR+   
Sbjct: 117 IERMSGRRVHQPSGRSYHVRFNPPKVEGRDDITGEELIQRDDDREDTVRNRLSVYREQTR 176

Query: 160 PLSSYY 165
           PL  YY
Sbjct: 177 PLVDYY 182


>gi|302390978|ref|YP_003826798.1| adenylate kinase [Acetohalobium arabaticum DSM 5501]
 gi|302203055|gb|ADL11733.1| Adenylate kinase [Acetohalobium arabaticum DSM 5501]
          Length = 213

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA RL  +  +P ++TGD+ R+ +   T LGK+ K  ++ G L+ 
Sbjct: 1   MHIILVGPPGAGKGTQAARLVDEFGIPHIATGDIFRSAIKNETPLGKKAKEYIDQGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+   DC  GFILDG+PRTV QA +L   ++++   +DAV+ + V +  +
Sbjct: 61  DEVTVGMVENRLAEDDCQEGFILDGFPRTVAQADALKDILTDLGIELDAVLNIEVGEEEV 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R                       +  + E   R DD+ +   +R+E Y++   
Sbjct: 121 VKRLSARRVCSECGASYHLEFDPPQKENTCDKCSGELYQRDDDEPETIKERLEVYKEKTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  IDG     EV   I   L
Sbjct: 181 PLIDYYQKTGDLKSIDGEAAPKEVFTRIKQEL 212


>gi|114771246|ref|ZP_01448666.1| adenylate kinase [alpha proteobacterium HTCC2255]
 gi|114548171|gb|EAU51058.1| adenylate kinase [alpha proteobacterium HTCC2255]
          Length = 217

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 112/217 (51%), Gaps = 23/217 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L +  N+ QLSTGDMLRA     T LGK V G M+ G L++
Sbjct: 1   MNIILIGPPGAGKGTQAATLVKDRNMIQLSTGDMLRAARTSGTELGKMVAGVMDRGELVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++      +GFI DG+PRT+ QA +L   +S +D  +D VI++ V+D ++
Sbjct: 61  DEIVIGLIEEQLTSSTESTGFIFDGFPRTLAQADALSNLLSKVDQKLDTVIQMTVDDEAL 120

Query: 121 FKRIQVRVLEAIASEK-----------------------SVRSDDKYDVFLKRIENYRKT 157
            +RI  R    +  +                          R+DD  D    R+  Y K 
Sbjct: 121 VRRITGRFTCGVCGQGYHEDFKAPIIKGKCDNCGEVGAFKKRADDNEDALKTRLMAYYKD 180

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSV 194
             PL  YY     L  I+G+  +DEV R I   + S+
Sbjct: 181 TSPLIGYYYAKQQLQQINGLNSIDEVGRDISEAISSI 217


>gi|255659524|ref|ZP_05404933.1| adenylate kinase [Mitsuokella multacida DSM 20544]
 gi|260848076|gb|EEX68083.1| adenylate kinase [Mitsuokella multacida DSM 20544]
          Length = 214

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 110/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA  L +  ++P +STGDM RA V   T LGKQ K  M++G L+ 
Sbjct: 1   MHILLMGPPGAGKGTQAAELVKAFDIPHISTGDMFRAAVKEGTELGKQAKACMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V +R+   DC  GFILDG+PRTV+QA +L   + ++   +  V+ + V    +
Sbjct: 61  DSVTIGIVRERLAKDDCKKGFILDGFPRTVEQADALTGILKDLGLTLTRVLNISVPAEDL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     + +   SE   R+DD  +    R+  Y  +  
Sbjct: 121 IERAVGRRICKKCGATYHTKFNPPKKEGICDVCGSELFQRADDTAETMKNRLSVYEASTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G    +DG   +++V++ +  +L
Sbjct: 181 PLIDYYKAAGVYTEVDGRQPIEKVTQDLIEVL 212


>gi|47086835|ref|NP_997761.1| adenylate kinase 2, mitochondrial [Danio rerio]
 gi|31418798|gb|AAH53160.1| Adenylate kinase 2 [Danio rerio]
          Length = 241

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 114/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LG+++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++ + +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  V+D+ +
Sbjct: 78  DEMVVELIDNNLDTPSCKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      +  E  + RSDD       R+E+Y +   
Sbjct: 138 VRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTS 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G    ID     D V  SI
Sbjct: 198 PLVQYYSARGLHTAIDASQSTDLVFASI 225


>gi|27468720|ref|NP_765357.1| adenylate kinase [Staphylococcus epidermidis ATCC 12228]
 gi|57867680|ref|YP_189373.1| adenylate kinase [Staphylococcus epidermidis RP62A]
 gi|251812068|ref|ZP_04826541.1| adenylate kinase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875363|ref|ZP_06284236.1| adenylate kinase [Staphylococcus epidermidis SK135]
 gi|293368454|ref|ZP_06615078.1| adenylate kinase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|29427433|sp|Q8CRI0|KAD_STAES RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|71153795|sp|Q5HM20|KAD_STAEQ RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|27316268|gb|AAO05443.1|AE016750_48 adenylate kinase [Staphylococcus epidermidis ATCC 12228]
 gi|57638338|gb|AAW55126.1| adenylate kinase [Staphylococcus epidermidis RP62A]
 gi|251804402|gb|EES57059.1| adenylate kinase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296128|gb|EFA88649.1| adenylate kinase [Staphylococcus epidermidis SK135]
 gi|291317412|gb|EFE57834.1| adenylate kinase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329731212|gb|EGG67582.1| adenylate kinase [Staphylococcus epidermidis VCU144]
 gi|329736452|gb|EGG72720.1| adenylate kinase [Staphylococcus epidermidis VCU028]
 gi|329737078|gb|EGG73333.1| adenylate kinase [Staphylococcus epidermidis VCU045]
          Length = 215

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 109/212 (51%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +G PG+GKGTQA  + +K  +P +STGDM R  +   T LGK+ K  M+ G L+ 
Sbjct: 1   MNIILMGLPGAGKGTQASEIVKKFPIPHISTGDMFRKAIKDETDLGKEAKSYMDRGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +RI   D   GF+LDG+PRT+DQA+SL   +S +D  IDAVI + V +  +
Sbjct: 61  DEVTVGIVKERISEDDAKKGFLLDGFPRTIDQAESLSQIMSELDREIDAVINIEVPEEEL 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   R+ E   +   +                    R DD  +    R+    K   
Sbjct: 121 MNRLTGRRICEKCGTTYHLVFNPPKVDGICDIDGGKLYQREDDNPETVSNRLSVNVKQSK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           P+  YY + G L  IDG  D+DEV+  +  +L
Sbjct: 181 PILEYYNNKGVLKNIDGSKDIDEVTNDVIDIL 212


>gi|149915866|ref|ZP_01904390.1| protein translocase subunit SecY [Roseobacter sp. AzwK-3b]
 gi|149810189|gb|EDM70035.1| protein translocase subunit SecY [Roseobacter sp. AzwK-3b]
          Length = 214

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 118/213 (55%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA  L ++ ++ QLSTGDMLR   D  T +G++V   M  G L++
Sbjct: 1   MNIILLGPPGAGKGTQAHHLVEERDMIQLSTGDMLREAKDSGTEMGRKVADVMARGDLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ ++++  D   GFI DG+PRT+ QA +L   +      +DAVIE++V+D ++
Sbjct: 61  DEIVIGLIREKLQ-GDKKGGFIFDGFPRTLAQADALAGLLKEQGETLDAVIEMQVDDTAL 119

Query: 121 FKRIQVR------------VLEAI----------ASEKSVRSDDKYDVFLKRIENYRKTI 158
            +RI  R            + + I           +E   R+DD  D   +R+  Y K  
Sbjct: 120 VQRITARSTCAGCGEVYNDITKPIPADGICPKCGGTEFKRRADDNEDSLKQRLMEYYKKT 179

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  ++G+ ++DEV  SI ++L
Sbjct: 180 SPLIGYYYANGQLESVNGLGEIDEVKASIAAVL 212


>gi|54297321|ref|YP_123690.1| adenylate kinase [Legionella pneumophila str. Paris]
 gi|81822585|sp|Q5X5F4|KAD_LEGPA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|53751106|emb|CAH12517.1| adenylate kinase [Legionella pneumophila str. Paris]
          Length = 218

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  L  +  +PQ+STGDMLRA + + T LG   +  MESG L+S
Sbjct: 1   MRLMLLGGPGAGKGTQASLLINRYKIPQISTGDMLRAAIAKGTPLGLSAQKIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R++ PDCD GF+ DG+PRT+ QA++L     + +  +D VIE+ V+D  +
Sbjct: 61  DDIIIGLVKERLKNPDCDRGFLFDGFPRTLVQAEAL----KDAEIHLDHVIEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                      I  E  + R DDK +   KR++ Y     
Sbjct: 117 IERISGRRIHQPSGRVYHVVNQPPKNPGVDDITGEPLIQRDDDKEETIRKRLQVYHSQTA 176

Query: 160 PLSSYYRDM 168
           PL  YY++ 
Sbjct: 177 PLVQYYKEW 185


>gi|7524346|ref|NP_037543.1| adenylate kinase 2, mitochondrial isoform b [Homo sapiens]
 gi|109001656|ref|XP_001106031.1| PREDICTED: adenylate kinase 2, mitochondrial isoform 2 [Macaca
           mulatta]
 gi|114555423|ref|XP_513289.2| PREDICTED: adenylate kinase 2 isoform 4 [Pan troglodytes]
 gi|1477653|gb|AAC13881.1| adenylate kinase 2B [Homo sapiens]
 gi|24024985|dbj|BAC16748.1| adenylate kinase isozyme 2 [Homo sapiens]
 gi|56202448|emb|CAI19351.1| adenylate kinase 2 [Homo sapiens]
 gi|59808289|gb|AAH90040.1| Adenylate kinase 2 [Homo sapiens]
 gi|119627889|gb|EAX07484.1| adenylate kinase 2, isoform CRA_b [Homo sapiens]
 gi|197692235|dbj|BAG70081.1| adenylate kinase 2 isoform b [Homo sapiens]
 gi|197692489|dbj|BAG70208.1| adenylate kinase 2 isoform b [Homo sapiens]
          Length = 232

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA RL++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 76  DEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R++ Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLIEYYRKRGIHSAIDASQTPDVVFASI 223


>gi|323701786|ref|ZP_08113457.1| adenylate kinase [Desulfotomaculum nigrificans DSM 574]
 gi|323533322|gb|EGB23190.1| adenylate kinase [Desulfotomaculum nigrificans DSM 574]
          Length = 213

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 113/216 (52%), Gaps = 24/216 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M ++ +GPPG+GKGTQA  L ++LN+  +STGDM RA +   T +GK+ K  M+ G+L+ 
Sbjct: 1   MNLLIMGPPGAGKGTQAEVLVKELNITHISTGDMFRAAIKEGTEMGKKAKEYMDKGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+  PDC  GF+LDG+PRTV+QA +L A + +M   +D VI + V    +
Sbjct: 61  DDVVIGMVKDRLSQPDCQKGFLLDGFPRTVEQAAALDATLQDMGIKLDGVINIEVPLEKL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +                          E   RSDD  +    R+  Y +   
Sbjct: 121 MARLTGRRVCKGCGASYHVIFNPPKEEGKCNTCGGELYQRSDDNEESVGTRLNAYIEKTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  YY   G L  I+G     E+S+ +  +L +V+
Sbjct: 181 PLIDYYAAKGILKNING---DQEISKVLADILAAVK 213


>gi|148358942|ref|YP_001250149.1| adenylate kinase [Legionella pneumophila str. Corby]
 gi|296106991|ref|YP_003618691.1| adenylate kinase [Legionella pneumophila 2300/99 Alcoy]
 gi|166980330|sp|A5IBQ3|KAD_LEGPC RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|148280715|gb|ABQ54803.1| adenylate kinase [Legionella pneumophila str. Corby]
 gi|295648892|gb|ADG24739.1| adenylate kinase [Legionella pneumophila 2300/99 Alcoy]
          Length = 218

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  L  +  +PQ+STGDMLRA + + T LG   +  MESG L+S
Sbjct: 1   MRLMLLGGPGAGKGTQASLLINRYKIPQISTGDMLRAAIAKGTPLGLSAQKIMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R++ PDCD GF+ DG+PRT+ QA++L     + +  +D VIE+ V+D  +
Sbjct: 61  DDIIIGLVKERLKNPDCDRGFLFDGFPRTLVQAEAL----KDAEIHLDHVIEIAVDDEEI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                      I  E  + R DDK +   KR++ Y     
Sbjct: 117 IERISGRRIHQPSGRVYHVVNQPPKNPGVDDITGEPLIQRDDDKEETIRKRLQVYHSQTA 176

Query: 160 PLSSYYRDM 168
           PL  YY++ 
Sbjct: 177 PLVQYYKEW 185


>gi|331091646|ref|ZP_08340480.1| adenylate kinase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403403|gb|EGG82962.1| adenylate kinase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 214

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAEKYGIPHISTGDIFRANIKNGTELGKKAKTYMDEGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR++  DC +G++LDG+PRT+ QA++L   ++ +   +D  I + V D ++
Sbjct: 61  DELVVDLVVDRVQQEDCKNGYVLDGFPRTIPQAEALDKALAELGEKMDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E  +R DDK +  LKR+  Y +   
Sbjct: 121 VNRMSGRRACVGCGATYHIVHAPTKVENICDTCGGELILRDDDKPETVLKRLGVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY D   L  +DG +D+++V ++I ++L
Sbjct: 181 PLIQYYTDKDILVEVDGTVDLEDVFKAIVNIL 212


>gi|325965298|ref|YP_004243203.1| adenylate kinase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323471385|gb|ADX75069.1| Adenylate kinase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 189

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 108/182 (59%), Gaps = 6/182 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ +GPPGSGKGTQA R+S++L V  +STGD+ RA V   T LG + +  ME+G  + D+
Sbjct: 1   MLIIGPPGSGKGTQAERISERLGVVAISTGDIFRANVKGETPLGVEARKYMENGDFVPDS 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           + N++V DR+   D ++GF+LDGYPRT  Q   L   +S  D  +D V++L  +D  +  
Sbjct: 61  VTNKMVRDRLGESDVENGFLLDGYPRTTAQVDYLDGILSAGDEKLDVVLQLTADDEELVH 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           R+  R      ++++ RSDD   V   R++ Y +    + + Y   G L  +DG+  +DE
Sbjct: 121 RLLGR------AKETGRSDDNETVIRHRLDLYHEQTEAVVAKYAGRGILTKVDGIGTVDE 174

Query: 183 VS 184
           V+
Sbjct: 175 VT 176


>gi|88192646|pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2
          Length = 242

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA RL++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 17  IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 76

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 77  DEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 136

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R++ Y     
Sbjct: 137 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTT 196

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 197 PLIEYYRKRGIHSAIDASQTPDVVFASI 224


>gi|284162433|ref|YP_003401056.1| adenylate kinase [Archaeoglobus profundus DSM 5631]
 gi|284012430|gb|ADB58383.1| adenylate kinase [Archaeoglobus profundus DSM 5631]
          Length = 217

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 109/203 (53%), Gaps = 21/203 (10%)

Query: 15  TQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVNQVVCDRIRL 74
           TQA ++ +K  +P ++TGD+LR  V + T LGK+ K  M+ G L+ D IV  +V +R++ 
Sbjct: 15  TQAKKIVEKYGIPHIATGDILREAVAKGTELGKKAKEYMDRGELVPDEIVIGIVRERLKQ 74

Query: 75  PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVR------- 127
           PDC+ GF+LDG+PRT+ QA++L   +  +  +IDAVI + V +  + KRI  R       
Sbjct: 75  PDCEKGFLLDGFPRTLKQAEALDEMLKELGKSIDAVIYIDVPEEEVVKRITYRRTCRNCG 134

Query: 128 -VLEAI-------------ASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYI 173
            V   I               E   R DDK DV  +R + Y +   PL  YY   G LY 
Sbjct: 135 AVYHLIYAPPKEDNKCDKCGGELYQRDDDKEDVVRQRFKVYMENTAPLIEYYEKKGILYR 194

Query: 174 IDGMLDMDEVSRSIDSLLVSVRK 196
           +DG   +DEV   ID +L  + K
Sbjct: 195 VDGTKSIDEVFAQIDEILQKIAK 217


>gi|327393017|dbj|BAK10439.1| adenylate kinase Adk [Pantoea ananatis AJ13355]
          Length = 214

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 112/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LG Q K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGNQAKAIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQEDCKNGFLLDGFPRTIPQADAM----KEAGIKVDFVLEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VERIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQLTA 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY           + IDG  ++ +VS  +  +L
Sbjct: 177 PLIAYYSKEAEAGHTAYHKIDGTRNVSDVSAELAKIL 213


>gi|238928134|ref|ZP_04659894.1| adenylate kinase [Selenomonas flueggei ATCC 43531]
 gi|238884094|gb|EEQ47732.1| adenylate kinase [Selenomonas flueggei ATCC 43531]
          Length = 215

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 112/213 (52%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II +GPPG+GKGTQA  L ++ NV  +STGDM R  V   T LGK+ K  M++G L+ 
Sbjct: 1   MQIILMGPPGAGKGTQAVNLVKRYNVLHISTGDMFREAVKEGTPLGKEAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDC-DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D++   +V +R+  PDC + GFILDG+PRTV+QA +L   + +   A+ AV+ + V  A 
Sbjct: 61  DSVTVGIVRERLSKPDCKEKGFILDGFPRTVEQADALAEILKDNGMALTAVLNISVPAAD 120

Query: 120 MFKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTI 158
           + +R   R                     V +    E   R+DD  +    R+  Y  + 
Sbjct: 121 LIERAVGRRICKSCGHSYHVKFNPTKVPGVCDDCGGETYQRADDSEETMKNRLSVYESST 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+  G    IDG  ++ +V   + ++L
Sbjct: 181 RPLIDYYKKAGVYKEIDGRQEIAKVEADLAAVL 213


>gi|4502013|ref|NP_001616.1| adenylate kinase 2, mitochondrial isoform a [Homo sapiens]
 gi|197102248|ref|NP_001124843.1| adenylate kinase 2, mitochondrial [Pongo abelii]
 gi|114555427|ref|XP_001165163.1| PREDICTED: adenylate kinase 2 isoform 3 [Pan troglodytes]
 gi|297282890|ref|XP_001105613.2| PREDICTED: adenylate kinase 2, mitochondrial isoform 1 [Macaca
           mulatta]
 gi|1708596|sp|P54819|KAD2_HUMAN RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|75062006|sp|Q5REI7|KAD2_PONAB RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|1209687|gb|AAC52061.1| adenylate kinase 2 [Homo sapiens]
 gi|1813880|gb|AAB41790.1| adenylate kinase 2A [Homo sapiens]
 gi|14424799|gb|AAH09405.1| Adenylate kinase 2 [Homo sapiens]
 gi|24024982|dbj|BAC16747.1| adenylate kinase isozyme 2 [Homo sapiens]
 gi|47682991|gb|AAH70127.1| Adenylate kinase 2 [Homo sapiens]
 gi|55726092|emb|CAH89820.1| hypothetical protein [Pongo abelii]
 gi|56202449|emb|CAI19352.1| adenylate kinase 2 [Homo sapiens]
 gi|61363469|gb|AAX42396.1| adenylate kinase 2 [synthetic construct]
 gi|119627891|gb|EAX07486.1| adenylate kinase 2, isoform CRA_d [Homo sapiens]
 gi|158256784|dbj|BAF84365.1| unnamed protein product [Homo sapiens]
          Length = 239

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA RL++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 76  DEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R++ Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLIEYYRKRGIHSAIDASQTPDVVFASI 223


>gi|33304113|gb|AAQ02564.1| adenylate kinase 2 [synthetic construct]
 gi|60654271|gb|AAX29828.1| adenylate kinase 2 [synthetic construct]
          Length = 240

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA RL++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 76  DEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R++ Y     
Sbjct: 136 IRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLIEYYRKRGIHSAIDASQTPDVVFASI 223


>gi|300932973|ref|ZP_07148229.1| adenylate kinase [Corynebacterium resistens DSM 45100]
          Length = 181

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS  L +P +STGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQASLLSDSLKIPHISTGDLFRANISQGTDLGKQAQEYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            ++   +V DR+  PD   GF+LDG+PRT++QA+ L   +     ++DAVI   V +  +
Sbjct: 61  TSVTANMVRDRLSQPDAADGFLLDGFPRTIEQAELLEEMLKEKGESLDAVINYVVSEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD  +    R++ YR    PL  +Y D+  L  ID    +
Sbjct: 121 VERMLAR----------GRNDDNEETIRTRLQVYRDETAPLIEHYGDL--LLNIDAEGSV 168

Query: 181 DEVS-RSIDSL 190
           +++S  ++D+L
Sbjct: 169 EDISTTTLDAL 179


>gi|145632599|ref|ZP_01788333.1| adenylate kinase [Haemophilus influenzae 3655]
 gi|145634653|ref|ZP_01790362.1| adenylate kinase [Haemophilus influenzae PittAA]
 gi|229846439|ref|ZP_04466547.1| adenylate kinase [Haemophilus influenzae 7P49H1]
 gi|144986794|gb|EDJ93346.1| adenylate kinase [Haemophilus influenzae 3655]
 gi|145268198|gb|EDK08193.1| adenylate kinase [Haemophilus influenzae PittAA]
 gi|229810532|gb|EEP46250.1| adenylate kinase [Haemophilus influenzae 7P49H1]
          Length = 214

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 111/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRIAQADCTNGFLLDGFPRTIPQADAL----KDSGVKIDFVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS---------------------VRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +   +                         +R+DDK +  L R+  Y K   
Sbjct: 117 VERMSGRRVHQTSGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQTS 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + +DG   ++EVS+ +D +L
Sbjct: 177 PLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKIL 213


>gi|52841641|ref|YP_095440.1| adenylate kinase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628752|gb|AAU27493.1| adenylate kinase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 236

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 25/189 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LG PG+GKGTQA  L  +  +PQ+STGDMLRA + + T LG   +  MESG L+S
Sbjct: 19  MRLMLLGGPGAGKGTQASLLINRYKIPQISTGDMLRAAIAKGTPLGLSAQKIMESGGLVS 78

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +R++ PDCD GF+ DG+PRT+ QA++L     + +  +D VIE+ V+D  +
Sbjct: 79  DDIIIGLVKERLKNPDCDRGFLFDGFPRTLVQAEAL----KDAEIHLDHVIEIAVDDEEI 134

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                      I  E  + R DDK +   KR++ Y     
Sbjct: 135 IERISGRRIHQPSGRVYHVVNQPPKNPGVDDITGEPLIQRDDDKEETIRKRLQVYHSQTA 194

Query: 160 PLSSYYRDM 168
           PL  YY++ 
Sbjct: 195 PLVQYYKEW 203


>gi|238754277|ref|ZP_04615634.1| Adenylate kinase [Yersinia ruckeri ATCC 29473]
 gi|238707524|gb|EEP99884.1| Adenylate kinase [Yersinia ruckeri ATCC 29473]
          Length = 214

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG + K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGLKAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC  GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQDDCRDGFLLDGFPRTIPQADAM----KEAGIKVDYVLEFDVPDELI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +A   E ++R DD+ D   KR+  Y +   
Sbjct: 117 VERIVGRRVHAPSGRVYHIKFNPPKVENKDDATGDELTLRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYYR   D G    + +DG  ++ EVS  + ++L
Sbjct: 177 PLVSYYRQEADAGHTQYFKLDGTRNVSEVSAELATIL 213


>gi|238759219|ref|ZP_04620386.1| Adenylate kinase [Yersinia aldovae ATCC 35236]
 gi|238702506|gb|EEP95056.1| Adenylate kinase [Yersinia aldovae ATCC 35236]
          Length = 214

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG + K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGLKAKEIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC  GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQDDCRDGFLLDGFPRTIPQADAM----KEAGIKVDYVLEFDVPDELI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +A   E ++R DD+ D   KR+  Y +   
Sbjct: 117 IERIVGRRVHAASGRVYHVKFNPPKVADKDDATGEELTIRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL SYYR   D G    + +DG   + EVS  + ++L
Sbjct: 177 PLVSYYRKEADAGNTQYFKLDGTRKVPEVSAELATIL 213


>gi|68536855|ref|YP_251560.1| adenylate kinase [Corynebacterium jeikeium K411]
 gi|260579213|ref|ZP_05847103.1| adenylate kinase [Corynebacterium jeikeium ATCC 43734]
 gi|123650266|sp|Q4JTB5|KAD_CORJK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|68264454|emb|CAI37942.1| adenylate kinase [Corynebacterium jeikeium K411]
 gi|258602699|gb|EEW15986.1| adenylate kinase [Corynebacterium jeikeium ATCC 43734]
          Length = 181

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 10/168 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS  L VP +STGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQASLLSDALKVPHISTGDLFRANISQGTDLGKQAQEYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            ++   +V DR+   D   GF+LDG+PRT++QA+ L   + +   ++DAVI   V +  +
Sbjct: 61  TSVTADMVRDRLNQEDAADGFLLDGFPRTIEQAELLEKMLQDDGHSLDAVINYVVSEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDM 168
             R+  R           R+DD  D    R+E YR    PL  +Y+D+
Sbjct: 121 VDRMLAR----------GRNDDNEDTIRTRLEVYRNETAPLIDHYKDV 158


>gi|328953137|ref|YP_004370471.1| Adenylate kinase [Desulfobacca acetoxidans DSM 11109]
 gi|328453461|gb|AEB09290.1| Adenylate kinase [Desulfobacca acetoxidans DSM 11109]
          Length = 215

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 110/214 (51%), Gaps = 23/214 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LG PG+GKGTQA  L +K  +PQ+STGD+LRA V   T +GK+ K  M++G L+ 
Sbjct: 1   MNLILLGGPGAGKGTQAKLLIEKYKIPQISTGDILRAAVKEGTAMGKKAKEYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DR++  D   GFILDG+PRTV QA++L A +  M   ID V+ + V++ ++
Sbjct: 61  DEVVIGIIEDRLKQSDAQKGFILDGFPRTVPQAEALDATLKKMGSKIDHVLSIEVDEEAL 120

Query: 121 FKRIQVR-----------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKT 157
             R+  R                       V +   S    R DD       R+  Y + 
Sbjct: 121 VTRLTGRRTCKNADCGQMYHIKFTPPKKEGVCDKCGSPLYQRDDDNEATVRSRLTTYNQA 180

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             PL  YY   G L  I G+  ++++   I  +L
Sbjct: 181 TKPLIDYYAKQGMLQTIKGVGGINDIFNKIVGIL 214


>gi|225571574|ref|ZP_03780570.1| hypothetical protein CLOHYLEM_07672 [Clostridium hylemonae DSM
           15053]
 gi|225159651|gb|EEG72270.1| hypothetical protein CLOHYLEM_07672 [Clostridium hylemonae DSM
           15053]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKFSIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+   DC  G++LDG+PRT+ QA++L   ++ +   +D  I++ V D ++
Sbjct: 61  DELVVDLVVDRVNQEDCRDGYVLDGFPRTIPQAEALDKALAELGQKVDYAIDVDVPDENI 120

Query: 121 FKRIQVR----------VLEAIASEKS-----------VRSDDKYDVFLKRIENYRKTIL 159
            +R+  R           LE   +EK            +R DDK +   KR+  Y +   
Sbjct: 121 IRRMGGRRACVTCGATYHLEYAPTEKDGICDTCGGGLILRDDDKPETVKKRLSVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY + G L  +DG  D+++V R+I  +L
Sbjct: 181 PLIDYYTNAGILKTVDGTADIEDVFRAIVEIL 212


>gi|85712673|ref|ZP_01043719.1| Adenylate kinase [Idiomarina baltica OS145]
 gi|85693523|gb|EAQ31475.1| Adenylate kinase [Idiomarina baltica OS145]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 113/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  L     +PQ+STGDMLRA +   + LGK+ K  M++G L+S
Sbjct: 1   MRIILLGAPGAGKGTQAQFLMNTFGIPQISTGDMLRAAIKSGSELGKKAKQVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+ ++V +RI  PDC +GF+LDG+PRT+ QA ++          +D V+E  V D  +
Sbjct: 61  DEIIIELVKERIAEPDCQNGFLLDGFPRTIPQADAMR----ENGIEVDYVLEFAVPDDVI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                          E  +R DD+     KR+  Y +   
Sbjct: 117 VERMSGRRVHPGSGRVYHIKHNPPKEEGKDDETGEELVIRPDDQEQTVRKRLAVYHEQTE 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+ +        + IDG   ++ VS+ + +LL
Sbjct: 177 PLVEYYQSLAKETDTEYHRIDGTQPVEAVSKELGALL 213


>gi|197122360|ref|YP_002134311.1| adenylate kinase [Anaeromyxobacter sp. K]
 gi|226741848|sp|B4UBC0|KAD_ANASK RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|196172209|gb|ACG73182.1| Adenylate kinase [Anaeromyxobacter sp. K]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 107/198 (54%), Gaps = 21/198 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA  LS +L +P +STGDM R    R T +GKQV+  M++G L++
Sbjct: 1   MILILLGPPGAGKGTQAKLLSSELGIPHISTGDMFRDHKARGTEIGKQVQAIMDAGGLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V +R+  PD   GFILDGYPRTV QA  L   + ++  +ID  +   V +  +
Sbjct: 61  DDITNAMVKERLSRPDVAPGFILDGYPRTVVQAGYLDGLLRSLGRSIDRALSYEVPEELV 120

Query: 121 FKRIQVR-------VLEAIASEKSVRS--------------DDKYDVFLKRIENYRKTIL 159
            +RI  R        +  ++     R+              DDK +   KR++ Y     
Sbjct: 121 VERISGRRSCPRCGAVYHVSQNPPHRAGFCDRDDTALVQREDDKPENVRKRMQEYGTKTE 180

Query: 160 PLSSYYRDMGCLYIIDGM 177
           PL  YYRD G L  ++G+
Sbjct: 181 PLKRYYRDRGELSDVEGV 198


>gi|317047217|ref|YP_004114865.1| adenylate kinase [Pantoea sp. At-9b]
 gi|316948834|gb|ADU68309.1| adenylate kinase [Pantoea sp. At-9b]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 113/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   T LG+Q K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGTELGQQAKAIMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI   DC +GF+LDG+PRT+ QA ++     N    +D V+E  V D  +
Sbjct: 61  DELVIALVKERITQEDCKNGFLLDGFPRTIPQADAMKEAGIN----VDFVLEFAVPDELI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A                        E + R DD+ +   KR+  Y +   
Sbjct: 117 VDRIVGRRVHAPSGRVYHVTYNPPKVAGKDDVTGEELTTRKDDQEETVRKRLVEYHQLTA 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL +YY           + IDG   + EVS  + ++L
Sbjct: 177 PLIAYYSKEAEAGNTQYHKIDGTRQVAEVSTQLAAIL 213


>gi|226363913|ref|YP_002781695.1| adenylate kinase [Rhodococcus opacus B4]
 gi|226242402|dbj|BAH52750.1| adenylate kinase [Rhodococcus opacus B4]
          Length = 187

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 110/191 (57%), Gaps = 13/191 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII  GPPG+GKGTQA  LS KL +P +STGD+ R+ +   T LG++ K  +++G L+ 
Sbjct: 1   MRIILTGPPGAGKGTQAQSLSSKLQLPHISTGDLFRSHIAEGTDLGRRAKTFLDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+   D  +GFILDG+PRTV QA +L  F++     I+AV++  + D ++
Sbjct: 61  DEVTIGMVVERLAADDATAGFILDGFPRTVAQAVALDEFLAEQLIQINAVLDFSIADDAV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R+  R           R+DD  DV  +R+  Y     PL  YY     L  +D   ++
Sbjct: 121 VGRMLAR----------GRADDTEDVIRRRLRVYHDETRPLLDYYS--ALLVSVDADGEV 168

Query: 181 DEV-SRSIDSL 190
           DE+ +R+I +L
Sbjct: 169 DEIYARAIGAL 179


>gi|291549398|emb|CBL25660.1| Adenylate kinase [Ruminococcus torques L2-14]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LG PG+GKGTQA ++++K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKLIMLGAPGAGKGTQAKKIAEKYSIPHISTGDIFRANIKNGTELGKKAKTFMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+   DC +G++LDG+PRT+ QA++L   ++ M   ID  I + V D ++
Sbjct: 61  DELVVDLVVDRVNQEDCKNGYVLDGFPRTIPQAEALDRALAEMGQKIDYAINVEVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E  +R DDK +  LKR+  Y +   
Sbjct: 121 VNRMSGRRACVDCGATYHIVYAPTAKEGICDKCGGELILRDDDKPETVLKRLGVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY + G L  +DG +D+++V  +I  +L
Sbjct: 181 PLIDYYTEAGVLREVDGTIDINDVFAAIVQIL 212


>gi|118444633|ref|YP_877219.1| adenylate kinase [Clostridium novyi NT]
 gi|166219984|sp|A0PXW7|KAD_CLONN RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|118135089|gb|ABK62133.1| adenylate kinase [Clostridium novyi NT]
          Length = 216

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ R  +   T LG + K  M+ G L+ 
Sbjct: 1   MRMILLGPPGAGKGTQAKLISEKYSIPHISTGDIFRKNISEKTPLGVKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC  GF+LDG+PRTV QA++L  F++  + ++D  + + V  + +
Sbjct: 61  DELTIDLVNDRLTHEDCKKGFLLDGFPRTVKQAEALEKFLTENNQSLDTALLIDVPSSFI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    E   R DD  +   +RIE Y +   
Sbjct: 121 LERMTGRRVCPSCGASYHIKFNPPKIEGLCDVCKKEVIQRKDDTEETVKERIEVYDRQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     L+++DG   +D+V  +I
Sbjct: 181 PLVDFYSSKDQLFVVDGTQSIDQVFETI 208


>gi|320335502|ref|YP_004172213.1| Adenylate kinase [Deinococcus maricopensis DSM 21211]
 gi|319756791|gb|ADV68548.1| Adenylate kinase [Deinococcus maricopensis DSM 21211]
          Length = 191

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/181 (42%), Positives = 107/181 (59%), Gaps = 7/181 (3%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPG+GKGTQA RL++ L++ ++STGD+LR  V R T LG QVK  ++ G L+SD 
Sbjct: 9   VIFLGPPGAGKGTQAERLARDLDLVKISTGDILRDHVARGTELGLQVKDVLDKGQLVSDD 68

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           I+  ++ D++   +     I DG+PRTV QA  L   +  +   I AV  L V D  + +
Sbjct: 69  ILIALIRDKLASLEA-VRVIFDGFPRTVAQAHDLDVLLEELGAPIHAVPLLEVPDEELIE 127

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDE 182
           RI  R       + S RSDD  +V  +R   YR+   PL  YYR  G L +IDG+  MD+
Sbjct: 128 RIVER------GKTSGRSDDTAEVARQRQAVYREQTQPLIEYYRARGHLRVIDGVGSMDD 181

Query: 183 V 183
           V
Sbjct: 182 V 182


>gi|290474631|ref|YP_003467511.1| adenylate kinase [Xenorhabdus bovienii SS-2004]
 gi|289173944|emb|CBJ80731.1| adenylate kinase [Xenorhabdus bovienii SS-2004]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 114/217 (52%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG + K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGLKAKELMDNGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI+  DC SGF+LDG+PRT+ QA ++          +D V+E  V DA +
Sbjct: 61  DELVIALVKERIKQDDCRSGFLLDGFPRTIPQADAM----KEAGIKVDYVLEFAVPDAII 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R + A                        E S+R DD+ D   KR+  Y     
Sbjct: 117 VERIIGRRVHAPSGRVYHIKFNQPKVENRDDVTGEELSIRKDDQEDTVRKRLVEYHAQTA 176

Query: 160 PLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
           PL SYY++           +DG   + EVS  +  +L
Sbjct: 177 PLVSYYQNEAQAGNTKYSKLDGTRQVAEVSEELVGIL 213


>gi|119511160|ref|ZP_01630277.1| adenylate kinase [Nodularia spumigena CCY9414]
 gi|119464148|gb|EAW45068.1| adenylate kinase [Nodularia spumigena CCY9414]
          Length = 186

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 105/192 (54%), Gaps = 10/192 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IFLGPPGSGKGTQA  L++ LN+P +STG++LR  +   T LG + +  + SG L+ D
Sbjct: 5   RLIFLGPPGSGKGTQAQILAEDLNIPHISTGEILRQAMQEQTPLGIKAQSYVNSGDLVPD 64

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  +V +R+  PD  SG+ILDG+PR V QA  L   ++ M+   + VI L   D  + 
Sbjct: 65  QLVQDLVQERLSQPDVKSGWILDGFPRKVTQAVFLEKLLAEMNQGGERVINLDAPDDVVV 124

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R           R DD   V   R++ YR    PL  YY D   L  ++G    +
Sbjct: 125 ARLLDR----------GRKDDTEAVIRHRLDVYRAETAPLIDYYGDRQKLLTVNGDQSQE 174

Query: 182 EVSRSIDSLLVS 193
           EV+  +  ++ S
Sbjct: 175 EVTHELQKIVTS 186


>gi|313895160|ref|ZP_07828717.1| adenylate kinase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976055|gb|EFR41513.1| adenylate kinase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 105/212 (49%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L ++  +  +STGDM R  V   T LGK+ K  M++G L+ 
Sbjct: 1   MHIILMGPPGAGKGTQATNLVKRYGILHISTGDMFREAVKEGTPLGKEAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++   +V  R+  PDC  GFILDG+PRTV+QA +L   + +    + AV+ + V    +
Sbjct: 61  DSVTIGIVRQRLSKPDCRKGFILDGFPRTVEQADALGEILKDNGLQLTAVLNINVPTEDL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     V +    E   R+DD  D    R+  Y  +  
Sbjct: 121 IERAVGRRICKSCGHSFHVKFNPTKVEGVCDDCGGETYQRADDSADTMKSRLSVYESSTR 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR  G    IDG  D+ +V   + + L
Sbjct: 181 PLIEYYRKAGVYKEIDGRQDIAKVEADLSAAL 212


>gi|148825367|ref|YP_001290120.1| adenylate kinase [Haemophilus influenzae PittEE]
 gi|166980324|sp|A5UAD6|KAD_HAEIE RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|148715527|gb|ABQ97737.1| adenylate kinase [Haemophilus influenzae PittEE]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 111/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDM RA +   T LGKQ K  M+ G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTELGKQAKALMDEGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DRI   DC +GF+LDG+PRT+ QA +L     +    ID V+E  V D  +
Sbjct: 61  DELTVALVKDRIAQADCANGFLLDGFPRTIPQADAL----KDSGVKIDFVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS---------------------VRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +   +                         +R+DDK +  L R+  Y K   
Sbjct: 117 VERMSGRRVHQTSGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLAVYHKQTS 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+          + +DG   ++EVS+ +D +L
Sbjct: 177 PLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKIL 213


>gi|117620262|ref|YP_857003.1| adenylate kinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|166980292|sp|A0KL52|KAD_AERHH RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|117561669|gb|ABK38617.1| adenylate kinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 214

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRI+ LG PG+GKGTQA  + +K  +PQ+STGDMLRA +   T LG + K  M++G L+S
Sbjct: 1   MRIVLLGAPGAGKGTQAQFIMEKHGIPQISTGDMLRAAIKAGTELGLKAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI  PDC +GF+LDG+PRT+ QA+++     +   A+D V+E  V D  +
Sbjct: 61  DDIIIGLVKERIAQPDCANGFLLDGFPRTIPQAQAM----KDAGVAVDFVLEFDVPDEEI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R + +                        +  +R+DD+     KR++ Y +   
Sbjct: 117 VKRMSGRRVHSGSGRTYHVVFNPPKVEGKDDVTGEDLVIRADDEETTVRKRLDVYHQQTA 176

Query: 160 PLSSYY----RDMGCLYI-IDGMLDMDEVSRSIDSLL 191
           PL  +Y          Y+ IDG   +D VS+ + ++L
Sbjct: 177 PLIGFYGKEAEAGNTRYVKIDGTQPVDLVSKQLATIL 213


>gi|327438299|dbj|BAK14664.1| adenylate kinase [Solibacillus silvestris StLB046]
          Length = 217

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 112/216 (51%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +G PG+GKGTQA ++ +K  +P +STGDM RA +   T LG Q K  M+ G+L+ 
Sbjct: 1   MNIVLMGLPGAGKGTQADKIVEKYAIPHISTGDMFRAAIKEGTELGLQAKAFMDQGALVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+  PDC+ GF+LDG+PRTV QA++L + +  +   ++  I ++VE   +
Sbjct: 61  DEVTIGIVRERLSQPDCEKGFLLDGFPRTVPQAEALDSILEELGRPVEHTINVQVEKEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +    E   R+DD  +    R+E       
Sbjct: 121 IARLSGRRICKTCGTSYHLVFNPPKVDGICDKDGGELYTRADDNPETVTNRLEVNMNQAQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y+  G L  I+G  ++ +V   +D+LL   R
Sbjct: 181 PLLDFYKAKGVLTNINGQQEISKVFADLDALLQGSR 216


>gi|119960842|ref|YP_948637.1| adenylate kinase [Arthrobacter aurescens TC1]
 gi|119947701|gb|ABM06612.1| Adenylate kinase (ATP-AMP transphosphorylase) [Arthrobacter
           aurescens TC1]
          Length = 192

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 109/183 (59%), Gaps = 6/183 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPGSGKGTQA R+S++L V  +STGD+ RA V   T LG + K  M++G  + D
Sbjct: 3   RMLIIGPPGSGKGTQAERISERLGVVAISTGDIFRANVKGETPLGIEAKKYMDAGDFVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++ N +V DR+   D ++GF+LDGYPRT  Q   L   ++  +  +D V++L  +D  + 
Sbjct: 63  SVTNNMVRDRLGQSDVENGFLLDGYPRTTAQVDYLDQILAEGEQELDVVLQLTADDEELV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            R+  R      ++++ RSDD   V   R++ Y +    + + Y + G L  +DG+  +D
Sbjct: 123 TRLLGR------AKETGRSDDNEAVIRHRLDLYHEQTEAVVAKYAERGILTQVDGIGGID 176

Query: 182 EVS 184
           EV+
Sbjct: 177 EVT 179


>gi|90416447|ref|ZP_01224378.1| adenylate kinase [marine gamma proteobacterium HTCC2207]
 gi|90331646|gb|EAS46874.1| adenylate kinase [marine gamma proteobacterium HTCC2207]
          Length = 216

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 117/219 (53%), Gaps = 32/219 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  ++ K +VPQ+STGDMLR+ V   T LG +VK  M SG L+S
Sbjct: 1   MRVILLGPPGAGKGTQAQFITDKYSVPQISTGDMLRSAVKAGTELGLKVKDIMTSGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V +RI  PDC+ GF+ DG+PRT+ QA++L     + +  I+ V+E+ V+D  +
Sbjct: 61  DEIIIALVKERIAQPDCNGGFLFDGFPRTIPQAQAL----VDANVPIEYVVEIAVDDEQI 116

Query: 121 FKRIQVR--------------------VLEAIASEKSV-RSDDKYDVFLKRIENYRKTIL 159
             R+  R                     L+ +  E  + R DDK +    R+  Y     
Sbjct: 117 VSRLSGRRVHEDSGRVYHIEHNPPNTAGLDDVTQETLIQRPDDKEETIRNRLSIYHSQTK 176

Query: 160 PLSSYYRDMGC-------LYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+ +            +DG+  +++V   + S L
Sbjct: 177 PLVEFYQGLSAKDADAPKFSTVDGLGSLNDVQARLVSAL 215


>gi|254491498|ref|ZP_05104677.1| adenylate kinases subfamily [Methylophaga thiooxidans DMS010]
 gi|224462976|gb|EEF79246.1| adenylate kinases subfamily [Methylophaga thiooxydans DMS010]
          Length = 215

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR + LG PGSGKGTQ   LS+K N+PQ+STGD+LRA V   T LGKQ K +M++G+L+S
Sbjct: 1   MRTVLLGAPGSGKGTQGVVLSKKFNIPQISTGDLLRAAVKAGTELGKQAKTAMDAGALVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +R+   D  +G+ILDG+PR + QA++L A +  +   +  V+ L V    +
Sbjct: 61  DDIVIGLIRERLSQEDAQNGYILDGFPRNIPQAEALDAMLDQLGQPLQGVVLLDVPFEEL 120

Query: 121 FKRIQVR------------VLEAIASEKSV---------RSDDKYDVFLKRIENYRKTIL 159
            +R+  R             L    SE            R DD  +    R++ Y +   
Sbjct: 121 MQRLTGRRTCKDCGAIYNIHLSPPKSEDQCDRCGGELFQREDDNEETIGNRLKVYEEQTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y+    L+ I G  D+D ++  + ++ 
Sbjct: 181 PLIGFYQKQAKLHSIAGTGDIDHITDQVGAVF 212


>gi|257453772|ref|ZP_05619053.1| adenylate kinase [Enhydrobacter aerosaccus SK60]
 gi|257448864|gb|EEV23826.1| adenylate kinase [Enhydrobacter aerosaccus SK60]
          Length = 218

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 111/214 (51%), Gaps = 32/214 (14%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           RII LGPPG+GKGTQA  ++++ N+PQ+STGDMLRA +   T LGKQ K  M++G L+SD
Sbjct: 3   RIILLGPPGAGKGTQAQIITKEFNIPQISTGDMLRAAIKEGTELGKQAKSIMDAGGLVSD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            ++  +V  RI  PDC +G I DG+PRT+ QA++L    ++    ID V+E+ V D  + 
Sbjct: 63  DLIINLVKARIAQPDCANGCIFDGFPRTIPQAQAL----ADAGVHIDNVVEIAVPDEDIV 118

Query: 122 KRI--------QVRVLEAIASEKSV-------------RSDDKYDVFLKRIENYRKTILP 160
            R+          RV   I +   V             R DDK D    R+  Y      
Sbjct: 119 SRLSGRRSHPASGRVYHVIYNPPKVEGKDDETGEDLVQREDDKEDTIRDRLATYHNQTEA 178

Query: 161 LSSYYRDMGC-------LYIIDGMLDMDEVSRSI 187
           L  +Y+D+             DG   +D+VS  +
Sbjct: 179 LVGFYQDLAKSGQNAPRYAKFDGTQAIDKVSEQV 212


>gi|315044885|ref|XP_003171818.1| adenylate kinase cytosolic [Arthroderma gypseum CBS 118893]
 gi|311344161|gb|EFR03364.1| adenylate kinase cytosolic [Arthroderma gypseum CBS 118893]
          Length = 269

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 111/209 (53%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA ++ +K  V  LSTGDMLR++V R T LGK  K  M+ G L+S
Sbjct: 42  MRMVLMGPPGAGKGTQAPKIKEKYCVCHLSTGDMLRSQVSRQTELGKAAKKIMDQGGLVS 101

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I+  ++ + +    +C  GFILDG+PRTV QA+ L   + +    +   IEL+++D  
Sbjct: 102 DEIMVGMIKNELESNKECKKGFILDGFPRTVAQAERLDDMLRDRKQTLQHAIELQIDDGL 161

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I  E  V RSDD  +   KR+  Y    
Sbjct: 162 LVSRITGRLIHPASGRSYHKIFNPPKKEMTDDITGEPLVQRSDDNAEALKKRLATYHAQT 221

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY++ G    ID   +  +V +SI
Sbjct: 222 APVVGYYKNTGIWSGIDASQEPGQVWKSI 250


>gi|254423030|ref|ZP_05036748.1| adenylate kinases subfamily [Synechococcus sp. PCC 7335]
 gi|196190519|gb|EDX85483.1| adenylate kinases subfamily [Synechococcus sp. PCC 7335]
          Length = 184

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 114/192 (59%), Gaps = 14/192 (7%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+IFLGPPG+GKGTQA  L Q  +VP +STGD+LRA V   T LG + +G M++G L+ D
Sbjct: 3   RLIFLGPPGAGKGTQAQMLCQSYDVPHISTGDILRAAVKEKTDLGLKAEGFMKAGELVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            ++  ++ +R+   D  +G++LDG+PR V+QA+ L+A +  +  + D VI L V D  + 
Sbjct: 63  DLILGLIRERLSKEDTANGWLLDGFPRNVEQAEFLNALLEEIGQSCDVVINLEVPDDVLV 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM- 180
           +R+  R           R DDK DV   R+E YR+   PL + Y     L  ++G  ++ 
Sbjct: 123 ERLLDR----------GRVDDKEDVIRNRLEVYREQTEPLIALYDGRNQLQSVNGNQELS 172

Query: 181 ---DEVSRSIDS 189
              DE+++ ++S
Sbjct: 173 LVTDELTKIVES 184


>gi|288554746|ref|YP_003426681.1| adenylate kinase [Bacillus pseudofirmus OF4]
 gi|288545906|gb|ADC49789.1| adenylate kinase [Bacillus pseudofirmus OF4]
          Length = 217

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA R+ +K  VP +STGDM RA +   T LG + K  M++G L+ 
Sbjct: 1   MNLILMGLPGAGKGTQAERIVEKYEVPHISTGDMFRAAIKGETELGLKAKSFMDAGELVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+   DC+ GF+LDG+PRTV QA++L   +++M+  +D V+ + V +  +
Sbjct: 61  DEVTIGIVRERLSKADCEKGFLLDGFPRTVAQAEALEDMLASMERKLDYVLNIDVPEQLL 120

Query: 121 FKRIQVRVLEAIA---------------------SEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R +   +                      E   R DDK +   KR+E  ++   
Sbjct: 121 MDRLTGRRVSPTSGKTYHMIYNPPKVEGKCDVDGGELIQRDDDKPETVKKRLEVNQQQAQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y + G L  IDG  D+++V   +D LL
Sbjct: 181 PLIDFYTEKGYLRTIDGDQDINKVFEDLDELL 212


>gi|84499821|ref|ZP_00998109.1| Adenylate kinase [Oceanicola batsensis HTCC2597]
 gi|84392965|gb|EAQ05176.1| Adenylate kinase [Oceanicola batsensis HTCC2597]
          Length = 214

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 114/213 (53%), Gaps = 23/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L    ++ QLSTGDMLR      T +GK V   M+SG L++
Sbjct: 1   MNIILLGPPGAGKGTQARKLVDDRDMIQLSTGDMLREARTSGTEMGKIVADVMDSGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++   +   GFI DG+PRT+ QA +L   + +   ++DAVIELRVE+ ++
Sbjct: 61  DDIVIGLIREKLE-GEKKGGFIFDGFPRTLAQADALEQLLGDCGESLDAVIELRVEEEAL 119

Query: 121 FKRIQVRVLEAI----------------------ASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R   A                        +E   R+DD  +    R+  Y K  
Sbjct: 120 VSRITGRSTCANCGEVYHDETKPIPADGKCSVCGGTEFKRRADDNEESLKTRLMEYYKQT 179

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L+ +DG+ +MDEV  SI  +L
Sbjct: 180 SPLIGYYYAKGKLHGVDGLAEMDEVETSIKGIL 212


>gi|239815619|ref|YP_002944529.1| adenylate kinase [Variovorax paradoxus S110]
 gi|259494023|sp|C5CKV9|KAD_VARPS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|239802196|gb|ACS19263.1| adenylate kinase [Variovorax paradoxus S110]
          Length = 218

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 17/182 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG+Q K  MESG L+S
Sbjct: 1   MRLILLGAPGAGKGTQAAFICQKYGIPQISTGDMLRAAVKAGTPLGQQAKAVMESGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V +RI  PDC  GF+ DG+PRT+ QA ++ A      ++  +D     +IE  
Sbjct: 61  DDLIINLVKERIAQPDCAGGFLFDGFPRTIPQADAMKAAGVKLDYVLEIDVPFSDIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   +V   + I  E  + R DD+ +   KR+E Y +   PL  
Sbjct: 121 SGRRSHPASGRTYHVKFNPPKVEGKDDITGEDLIQRKDDEEETVRKRLEVYSQQTRPLVD 180

Query: 164 YY 165
           YY
Sbjct: 181 YY 182


>gi|297582470|ref|YP_003698250.1| adenylate kinase [Bacillus selenitireducens MLS10]
 gi|297140927|gb|ADH97684.1| adenylate kinase [Bacillus selenitireducens MLS10]
          Length = 217

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 117/217 (53%), Gaps = 21/217 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I +G PG+GKGTQA ++ ++ N+P +STGDM RA +   T LG + K  M+ G+L+ 
Sbjct: 1   MNLILMGLPGAGKGTQAEKIVEQYNIPHISTGDMFRAAIKNGTELGLKAKAFMDEGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V +R+   DC  GF+LDG+PRTV QA +L   ++++D  +D VI ++V +  +
Sbjct: 61  DEVTVGIVKERLSQDDCSDGFLLDGFPRTVAQASALEEMLASLDRKLDHVIYVQVPEEEL 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
           FKR+  R +                     +   S+   R DD+ +   KR++   +   
Sbjct: 121 FKRLTGRWICPTCGTAYHEVFNPPKENGKCDKDGSDLMQRDDDRPETVEKRLKVNMEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  +Y + G L  IDG  ++  V   I+ LL   R+
Sbjct: 181 PLVDFYSEKGYLRDIDGNREIGNVFADIEDLLKGSRQ 217


>gi|254517491|ref|ZP_05129547.1| adenylate kinase [Clostridium sp. 7_2_43FAA]
 gi|226911240|gb|EEH96441.1| adenylate kinase [Clostridium sp. 7_2_43FAA]
          Length = 218

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 118/216 (54%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++I+ LGPPG+GKGTQA  +S + ++P +STGD+ R  +  NT LG + K  ++ G L+ 
Sbjct: 3   VKIVLLGPPGAGKGTQAKSISNRYSIPHISTGDIFRKNISENTPLGVEAKKHIDKGQLVP 62

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR++  DC +G++LDG+PRTV+QA++L  F+S  +  +D  + + V    +
Sbjct: 63  DEVTINMVKDRLQQDDCKNGYLLDGFPRTVNQAEALQEFLSERNENLDTALLIEVPTGFI 122

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   S+   R DD  +   +R++ Y +   
Sbjct: 123 LERMTGRRVCPSCGASYHIKFNPPTITGKCDVCGSDIIQRKDDTEETVSERLDVYERQTQ 182

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL  +Y++   L I+DG   ++EV   I ++L SV 
Sbjct: 183 PLIDFYKERNLLSIVDGTKAINEVFEGICNILGSVE 218


>gi|168187793|ref|ZP_02622428.1| adenylate kinase [Clostridium botulinum C str. Eklund]
 gi|169294326|gb|EDS76459.1| adenylate kinase [Clostridium botulinum C str. Eklund]
          Length = 216

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +S+K ++P +STGD+ R  +   T LG + K  M+ G L+ 
Sbjct: 1   MRMILLGPPGAGKGTQAKLISEKYSIPHISTGDIFRKNISEKTPLGVKAKEYMDKGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC  GF+LDG+PRTV QA++L  F++  + ++D  + + V  + +
Sbjct: 61  DELTIDLVNDRLTHEDCKKGFLLDGFPRTVKQAEALEKFLTENNQSLDTALLIDVPSSFI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                     + +    E   R DD  +   +RIE Y +   
Sbjct: 121 LERMTGRRVCPSCGASYHIKFNPPKIEGLCDVCKKEIIQRKDDTEETVKERIEVYDRQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  +Y     L+++DG   +D+V  +I
Sbjct: 181 PLVDFYSSKDQLFVVDGTQSIDQVFETI 208


>gi|85058671|ref|YP_454373.1| adenylate kinase [Sodalis glossinidius str. 'morsitans']
 gi|123519907|sp|Q2NV57|KAD_SODGM RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|84779191|dbj|BAE73968.1| adenylate kinase [Sodalis glossinidius str. 'morsitans']
          Length = 214

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 117/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG+Q K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAQSELGRQAKALMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +  +RI+   C +GF+LDG+PRT+ QA ++      +  A+D V+E  V D+ +
Sbjct: 61  DELVIALAKERIKQDHCRNGFLLDGFPRTLPQADAM----KEVGIAVDYVLEFAVPDSLI 116

Query: 121 FKRIQVRVLEAIASEK---------------------SVRSDDKYDVFLKRIENYRKTIL 159
             RI  R + A +                        + R DD+ D   KR+  Y +   
Sbjct: 117 IDRIVGRRVHAPSGRVYHVKFNPPKQEGKDDVTGELLTSRKDDQEDTVRKRLVEYHQQTA 176

Query: 160 PLSSYYR---DMGC--LYIIDGMLDMDEVSRSIDSLL 191
           PL  YYR   D G    + +DG  ++ EVS  + ++L
Sbjct: 177 PLIDYYRKEADAGNTRYFTLDGTRNVSEVSAELAAIL 213


>gi|188578476|ref|YP_001915405.1| adenylate kinase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188522928|gb|ACD60873.1| adenylate kinase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 182

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 104/186 (55%), Gaps = 6/186 (3%)

Query: 6   LGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDAIVN 65
           +GPPGSGKGTQA RL     +P +STGD+LRAEV   + LG + K  M  G L+SD I+ 
Sbjct: 1   MGPPGSGKGTQATRLKDTFEIPHISTGDLLRAEVAAGSPLGLKAKEVMARGDLVSDDILL 60

Query: 66  QVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQ 125
            ++  R+   D   GFILDGYPR V QA +L A +S +   +DAV++L V    + +RI 
Sbjct: 61  GMLEARLGQADVAKGFILDGYPRNVAQANALCALLSKIGQPLDAVVQLDVASELLVERIA 120

Query: 126 VRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMDEVSR 185
            R      ++   R DD  +   KR++ Y  +  P+  +Y   G L  +DG+  +DEV  
Sbjct: 121 GR------AKAEGREDDNPESVRKRLQVYTDSTAPVIGFYEQRGKLTRVDGVGSLDEVLE 174

Query: 186 SIDSLL 191
            I   L
Sbjct: 175 RIRKAL 180


>gi|123888105|sp|Q1L8L9|KAD2_DANRE RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2;
           AltName: Full=ATP-AMP transphosphorylase 2
 gi|94733765|emb|CAK04357.1| adenylate kinase 2 [Danio rerio]
 gi|94734568|emb|CAK11314.1| adenylate kinase 2 [Danio rerio]
          Length = 241

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 114/208 (54%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA +L++K  V  L+TGDMLRA V   + LG+++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++ + +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  V+D+ +
Sbjct: 78  DEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      +  E  + RSDD       R+E+Y +   
Sbjct: 138 VRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTS 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G    ID     D V  SI
Sbjct: 198 PLVQYYSARGLHTAIDASQSTDLVFASI 225


>gi|225555520|gb|EEH03812.1| adenylate kinase cytosolic [Ajellomyces capsulatus G186AR]
 gi|325094831|gb|EGC48141.1| adenylate kinase [Ajellomyces capsulatus H88]
          Length = 277

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 114/210 (54%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++  K  V  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPKIKDKFCVCHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L   +++    +   +EL+++D+ 
Sbjct: 106 DEIMVNMIKHELENNKECQNGFILDGFPRTVAQAERLDGMLNSRGQKLQHAVELQIDDSL 165

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR++ Y   
Sbjct: 166 LVARITGRLVHP-ASGRSYHKIFNPPKEAMKDDVTGEPLIQRSDDNADALKKRLKTYHSQ 224

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 225 TEPVVGYYKTTGIWKGIDASQEPGQVWKSL 254


>gi|226489905|emb|CAX75103.1| Adenylate kinase 2 [Schistosoma japonicum]
 gi|226489907|emb|CAX75104.1| Adenylate kinase 2 [Schistosoma japonicum]
 gi|226489909|emb|CAX75105.1| Adenylate kinase 2 [Schistosoma japonicum]
          Length = 236

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 114/206 (55%), Gaps = 21/206 (10%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           ++ +GPPGSGKGTQA +LS+   +  LSTGDMLRA +   + LG +VK   ESG L+SD 
Sbjct: 22  LVLIGPPGSGKGTQAAKLSKHYGICHLSTGDMLRAIIASGSELGLKVKKITESGGLVSDD 81

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++  +I  P+C+ G + DG+PRT++QAK L   +S+    + A +EL+ + + +  
Sbjct: 82  IVCDLIAQKIDSPECEKGLLFDGFPRTIEQAKKLDKLLSDRHIQLSAALELKADPSLLEN 141

Query: 123 RI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPL 161
           RI                    +V +++ I  ++ V RSDDK +   KR+  Y K   P 
Sbjct: 142 RICGRLFHLSSGRSYHELFNPPEVPMVDDITGDRLVRRSDDKPEALKKRLYEYEKNAAPA 201

Query: 162 SSYYRDMGCLYIIDGMLDMDEVSRSI 187
            S+Y+    L  +D   D+++V   I
Sbjct: 202 LSFYKSQNKLMQVDANNDVNQVFSDI 227


>gi|300857225|ref|YP_003782209.1| adenylate kinase [Clostridium ljungdahlii DSM 13528]
 gi|300437340|gb|ADK17107.1| adenylate kinase [Clostridium ljungdahlii DSM 13528]
          Length = 217

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 115/217 (52%), Gaps = 21/217 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LGPPG+GKGTQA  +S++ ++P +STGD+ R  +   T LG + K  +++G L+ 
Sbjct: 1   MRIILLGPPGAGKGTQAKFISEEYSIPHISTGDIFRKNISEKTPLGVEAKKYLDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR+   DC  GF+LDG+PRTV+QA++L  F++N    ID  + + V    +
Sbjct: 61  DEVTINIVKDRLGKDDCKEGFLLDGFPRTVNQAEALDLFLNNKGQKIDTALLIDVPKELI 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
            +R+   RV  +  +   V                    R DD       R++ Y K   
Sbjct: 121 LERMTGRRVCPSCGASYHVKFNPTKVEGKCDVCHNDVIQRKDDTESTVKDRLDVYDKQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           PL  YY+    L I+DG  +++EV + +   L S+ K
Sbjct: 181 PLIGYYKKQKALSIVDGTGEINEVFQRVKESLKSICK 217


>gi|255931643|ref|XP_002557378.1| Pc12g05310 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211581997|emb|CAP80158.1| Pc12g05310 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 257

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 111/209 (53%), Gaps = 22/209 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I +GPPG+GKGTQA  L +K     L+TGDMLR++V + T LGK+ K  M+ G L+S
Sbjct: 43  MRMILMGPPGAGKGTQAPNLKEKYCACHLATGDMLRSQVAKKTDLGKEAKKIMDQGGLVS 102

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I +N +  +     +C +GFILDG+PRTV QA+ L   +   D  +   +EL+++D+ 
Sbjct: 103 DEIMINMIKSELDNNAECKNGFILDGFPRTVAQAERLDDMLVARDQKLQHAVELQIDDSL 162

Query: 120 MFKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTI 158
           +  RI  R++                      I+ E  + RSDD  D   KR+  Y    
Sbjct: 163 LVARITGRLVHPASGRSYHKIFNPPKEDMKDDISGEPLIQRSDDNADTLTKRLATYHAQT 222

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
            P+  YY+  G    ID   +  +V +SI
Sbjct: 223 TPVVEYYKKTGIWRGIDASQEPGQVWKSI 251


>gi|15807111|ref|NP_295840.1| adenylate kinase [Deinococcus radiodurans R1]
 gi|9910714|sp|Q9RSK7|KAD_DEIRA RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|6459913|gb|AAF11666.1|AE002046_12 adenylate kinase [Deinococcus radiodurans R1]
          Length = 197

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 109/186 (58%), Gaps = 3/186 (1%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +IFLGPPG+GKGTQA RL+Q+  + QLSTGD+LR  V R T LG+Q    ME+G L+ D 
Sbjct: 9   VIFLGPPGAGKGTQAARLAQEHQLVQLSTGDILRDHVARGTALGQQAGPLMEAGQLVPDE 68

Query: 63  IVNQVVCDRIRLPDCDS-GFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++  ++ D  RL D +    I DG+PRT  QA++L   +  +   + AV  L V D  + 
Sbjct: 69  LLIALIRD--RLADMEPVRVIFDGFPRTQAQAEALDLLLEELGAPVSAVPLLEVPDQVLI 126

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
            RI  R  +A+A  ++ R+DD  +   KR + YR+   PL  YY   G LY +DG+   D
Sbjct: 127 DRIVDRGRQAVAEGRAPRADDNEETARKRQQVYREQTQPLIDYYARRGHLYTVDGLGTPD 186

Query: 182 EVSRSI 187
           EV   I
Sbjct: 187 EVYERI 192


>gi|290968223|ref|ZP_06559766.1| adenylate kinase [Megasphaera genomosp. type_1 str. 28L]
 gi|290781705|gb|EFD94290.1| adenylate kinase [Megasphaera genomosp. type_1 str. 28L]
          Length = 216

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 105/208 (50%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GPPG+GKGTQA RL +   +PQ+STGDM RA V   T LG + K  M++G L+ 
Sbjct: 1   MYILLMGPPGAGKGTQAERLIETYGIPQISTGDMFRAAVKEQTPLGLEAKKYMDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA+   +V +R+   DC  GFILDG+PRT  QA SL A + ++   ++ V+ + V D  +
Sbjct: 61  DAVTVGIVKERLAKDDCKKGFILDGFPRTTSQAVSLDAILQDLGIKLNGVVNIAVPDEEL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     V +        R DDK +   KR+  Y     
Sbjct: 121 VRRTTGRQICRSCGATYHITFKPSKKAGVCDKCGGALYQRDDDKMETVKKRLCVYAAQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY++      I+G  +MD V   I
Sbjct: 181 PLIDYYKNSNLYIEINGAREMDAVFNDI 208


>gi|110800006|ref|YP_697073.1| adenylate kinase [Clostridium perfringens ATCC 13124]
 gi|110803642|ref|YP_699642.1| adenylate kinase [Clostridium perfringens SM101]
 gi|168205213|ref|ZP_02631218.1| adenylate kinase [Clostridium perfringens E str. JGS1987]
 gi|168211884|ref|ZP_02637509.1| adenylate kinase [Clostridium perfringens B str. ATCC 3626]
 gi|168215197|ref|ZP_02640822.1| adenylate kinase [Clostridium perfringens CPE str. F4969]
 gi|168216652|ref|ZP_02642277.1| adenylate kinase [Clostridium perfringens NCTC 8239]
 gi|169347079|ref|ZP_02866021.1| adenylate kinase [Clostridium perfringens C str. JGS1495]
 gi|182626945|ref|ZP_02954678.1| adenylate kinase [Clostridium perfringens D str. JGS1721]
 gi|123145891|sp|Q0SQG5|KAD_CLOPS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123148516|sp|Q0TMR7|KAD_CLOP1 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|110674653|gb|ABG83640.1| adenylate kinase [Clostridium perfringens ATCC 13124]
 gi|110684143|gb|ABG87513.1| adenylate kinase [Clostridium perfringens SM101]
 gi|169296762|gb|EDS78891.1| adenylate kinase [Clostridium perfringens C str. JGS1495]
 gi|170663256|gb|EDT15939.1| adenylate kinase [Clostridium perfringens E str. JGS1987]
 gi|170710173|gb|EDT22355.1| adenylate kinase [Clostridium perfringens B str. ATCC 3626]
 gi|170713401|gb|EDT25583.1| adenylate kinase [Clostridium perfringens CPE str. F4969]
 gi|177907735|gb|EDT70350.1| adenylate kinase [Clostridium perfringens D str. JGS1721]
 gi|182381130|gb|EDT78609.1| adenylate kinase [Clostridium perfringens NCTC 8239]
          Length = 216

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 117/214 (54%), Gaps = 21/214 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+ LGPPG+GKGTQA  +S + ++P +STGD+ R  +  NT LG + K  M++G L+ 
Sbjct: 1   MKIVLLGPPGAGKGTQAKSISNRYSIPHISTGDIFRKNISENTPLGIEAKSYMDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR++  DC +G++LDG+PRTV QA++L  F++  + +ID  + + V    +
Sbjct: 61  DEVTINMVKDRLQQDDCKNGYLLDGFPRTVHQAEALDNFLTEREESIDTALLIEVPKEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   S+   R DD  +   +R++ Y     
Sbjct: 121 LERMTGRRVCPSCGASYHIKFNPPTNDGKCDLCGSDVIQRKDDTEETVKERLDVYENQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
           PL  +Y++   L ++DG   ++EV  SI  +L S
Sbjct: 181 PLIDFYKNKKQLSVVDGTQAINEVFESICKILGS 214


>gi|283768442|ref|ZP_06341354.1| adenylate kinase [Bulleidia extructa W1219]
 gi|283104834|gb|EFC06206.1| adenylate kinase [Bulleidia extructa W1219]
          Length = 216

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 116/216 (53%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GP G+GKGT +  +  K +VP +STGDM R  +  NT LG + K  ME+G L+ 
Sbjct: 1   MNILIMGPAGAGKGTMSKEIKTKYSVPHISTGDMFRENIKNNTPLGTKAKEYMEAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D++VN +V DR++  DC +G++LDG+PR++ QA++L    S ++ ++D  + L V+ A +
Sbjct: 61  DSLVNDMVEDRLQQDDCANGYLLDGFPRSLGQAEALTKITSKINRSVDVALVLDVDIAVL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R                     V +  +SE + R DD  +    R+  YRK   
Sbjct: 121 EERITGRRICKNCGSIYHIKNHPSKVEGVCDVCSSELTQRKDDTLEQLQVRMNEYRKQTE 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           P+  YY   G    ++     D+V   I S+L SV+
Sbjct: 181 PVIQYYEKQGIAKHVNAGQKPDKVFADIQSILDSVK 216


>gi|154270214|ref|XP_001535964.1| adenylate kinase cytosolic [Ajellomyces capsulatus NAm1]
 gi|224493044|sp|A6RHI1|KAD1_AJECN RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|150410097|gb|EDN05485.1| adenylate kinase cytosolic [Ajellomyces capsulatus NAm1]
          Length = 277

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 115/210 (54%), Gaps = 24/210 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R+I +GPPG+GKGTQA ++  K  V  L+TGDMLR++V R T LGK+ K  M+ G L+S
Sbjct: 46  VRMILMGPPGAGKGTQAPKIKDKFCVCHLATGDMLRSQVARKTELGKEAKKIMDQGGLVS 105

Query: 61  DAI-VNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I VN +  +     +C +GFILDG+PRTV QA+ L + +++    +   +EL+++D+ 
Sbjct: 106 DEIMVNMIKHELENNKECQNGFILDGFPRTVAQAERLDSMLNSRGQKLQHAVELQIDDSL 165

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR++ Y   
Sbjct: 166 LVARITGRLVHP-ASGRSYHKIFNPPKEAMKDDVTGEPLIQRSDDNADALKKRLKTYHSQ 224

Query: 158 ILPLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
             P+  YY+  G    ID   +  +V +S+
Sbjct: 225 TEPVVGYYKTTGIWRGIDASQEPGQVWKSL 254


>gi|330427895|gb|AEC19229.1| adenylate kinase [Pusillimonas sp. T7-7]
          Length = 218

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 106/191 (55%), Gaps = 25/191 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA  +++K  +PQ+STGDMLRA V   T LG + K  M++G L+S
Sbjct: 1   MRLILLGPPGAGKGTQAAFITEKFGIPQISTGDMLRAAVKAQTPLGLEAKKIMDTGGLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  +V DR++ PDC  G++ DG+PRT+ QA +L     +    +D V+E+ V + ++
Sbjct: 61  DDIIIGLVRDRLKQPDCHDGYLFDGFPRTIPQADAL----KDAGVKLDFVVEIVVPEENI 116

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                      I+ E  V R DDK +    R+  YR+   
Sbjct: 117 IERMSGRRVHPASGRSYHTVFNPPKTPDVDDISGEPLVQRDDDKEETVRNRLAVYREQTR 176

Query: 160 PLSSYYRDMGC 170
           PL  YY +   
Sbjct: 177 PLVDYYSEWAA 187


>gi|321263607|ref|XP_003196521.1| adenylate kinase [Cryptococcus gattii WM276]
 gi|317462998|gb|ADV24734.1| Adenylate kinase, putative [Cryptococcus gattii WM276]
          Length = 269

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 112/215 (52%), Gaps = 24/215 (11%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++ +GPPG+GKGTQA  +S K  +  L+TGDMLR +V + T LG+  K  M+ G L+SD
Sbjct: 53  RMVLIGPPGAGKGTQAPNISSKYCICHLATGDMLREQVAKQTELGRAAKQIMDQGGLVSD 112

Query: 62  AIVNQVVCDRI-RLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
            I+  ++   + +  +C +GFILDG+PRTV QA  L A ++    AID  IEL++ DA +
Sbjct: 113 EIMVGMIRQELDKNAECKNGFILDGFPRTVPQASKLDAMLAERKQAIDHAIELKIPDALL 172

Query: 121 FKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKTI 158
             RI  R++   AS +S                       RSDD      KR++ Y    
Sbjct: 173 ISRITGRLIHP-ASGRSYHREFNPPKKPMTDDITGEPLIQRSDDNVGTLRKRLDTYHAQT 231

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVS 193
            P+  YY+  G    +D       V  SI S+L S
Sbjct: 232 GPVVDYYKGTGVWTPVDAAQSPKLVWASISSILES 266


>gi|304405595|ref|ZP_07387254.1| adenylate kinase [Paenibacillus curdlanolyticus YK9]
 gi|304345634|gb|EFM11469.1| adenylate kinase [Paenibacillus curdlanolyticus YK9]
          Length = 216

 Score =  130 bits (327), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 115/216 (53%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+F+GPPG+GKGTQA R+  + +VP +STGD  R  + + T +G + K  ++ G L+ 
Sbjct: 1   MNILFMGPPGAGKGTQAERIVDQFSVPHISTGDAFRLAMKQGTPMGLKAKEFVDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I N +V DR+   DC +GF+LDG+PRT+ QA++L + +++M   ID V+ L+V+   +
Sbjct: 61  DEITNGIVRDRLLQDDCSNGFLLDGFPRTLQQAEALDSMLADMGRTIDHVVNLKVDRGLL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     V +    E   RSDD  +    R++ Y     
Sbjct: 121 LARLTGRRICKSCGSTYHVMFNPPKQEGVCDKCEGELYQRSDDTEEKVGTRLDEYISKTA 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           PL +YY     L  +DG  D+D V+  I S+L   R
Sbjct: 181 PLLAYYDGKSQLREVDGEQDIDVVTAEIVSVLRGSR 216


>gi|255079982|ref|XP_002503571.1| predicted protein [Micromonas sp. RCC299]
 gi|226518838|gb|ACO64829.1| predicted protein [Micromonas sp. RCC299]
          Length = 189

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 101/165 (61%), Gaps = 7/165 (4%)

Query: 3   IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISDA 62
           +I  GPPG+GKGT A ++  KL +PQLSTGDMLRA V   T +GK+ K +M+SG+L++D 
Sbjct: 1   LILFGPPGAGKGTHAPKIVDKLRIPQLSTGDMLRAAVAAGTEVGKRAKAAMDSGALVTDE 60

Query: 63  IVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFK 122
           IV  ++ DRI+  DC  GFILDG+PRTV+Q+K L A ++     +  V+EL V DA + +
Sbjct: 61  IVVGIIADRIKEDDCARGFILDGFPRTVEQSKMLDAELAKTGEEVSRVLELSVPDAVLTE 120

Query: 123 RIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
           RI  R +     + S RS   Y V     ++ R    P +   RD
Sbjct: 121 RICGRWVH----KGSGRS---YHVKFAPPKSLRPGETPGTENMRD 158


>gi|254449581|ref|ZP_05063018.1| adenylate kinase [Octadecabacter antarcticus 238]
 gi|198263987|gb|EDY88257.1| adenylate kinase [Octadecabacter antarcticus 238]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 114/213 (53%), Gaps = 22/213 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II LGPPG+GKGTQA +L    ++ QLSTGDMLRA     T +GK+V   M++G+L++
Sbjct: 1   MNIILLGPPGAGKGTQARKLVDDRDMVQLSTGDMLRAARSSGTAMGKKVAAVMDAGNLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  ++ +++       GFI DG+PRT+ QA +L   ++ M   ID V+E+ V+D ++
Sbjct: 61  DDIVIGLIREQLSDTSHAGGFIFDGFPRTLAQADALAELVAEMGQKIDHVVEMAVDDDAL 120

Query: 121 FKRIQVRVL----------------------EAIASEKSVRSDDKYDVFLKRIENYRKTI 158
             RI  R                           +++++ R+DD  D    R+  Y K  
Sbjct: 121 VARITARSTCGECGEVYNDNTKPWPADGKCSNCGSTDQTRRADDNEDSLKTRLMAYYKQT 180

Query: 159 LPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
            PL  YY   G L  ++G+  MDEV+  I  +L
Sbjct: 181 SPLVGYYYAKGQLSSVNGLGSMDEVAGEIAGVL 213


>gi|153816229|ref|ZP_01968897.1| hypothetical protein RUMTOR_02478 [Ruminococcus torques ATCC 27756]
 gi|317501795|ref|ZP_07959981.1| adenylate kinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088684|ref|ZP_08337594.1| hypothetical protein HMPREF1025_01177 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145846412|gb|EDK23330.1| hypothetical protein RUMTOR_02478 [Ruminococcus torques ATCC 27756]
 gi|316896828|gb|EFV18913.1| adenylate kinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407207|gb|EGG86710.1| hypothetical protein HMPREF1025_01177 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 264

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 120/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA ++++K ++P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 51  MKIIMLGAPGAGKGTQAKKIAEKYSIPHISTGDIFRANIKNGTELGKKAKTYMDQGLLVP 110

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+   DC +G++LDG+PRT+ QA++L   +++M   ID  I++ V D ++
Sbjct: 111 DELVVDLVVDRVNQDDCANGYVLDGFPRTIPQAEALDKALADMGQKIDYAIDVEVPDENI 170

Query: 121 FKRIQVR-----------VLEAIASEKSV----------RSDDKYDVFLKRIENYRKTIL 159
             R+  R           ++ A   E+ +          R DDK +  LKR+  Y     
Sbjct: 171 VNRMSGRRACVDCGATYHLVYAPTKEEGICDKCGGGLILRDDDKPETVLKRLGVYHDQTQ 230

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY   G L  +DG +D+D+V   I  +L
Sbjct: 231 PLIDYYTQSGILKEVDGTIDIDDVFAEIVRIL 262


>gi|213964931|ref|ZP_03393130.1| adenylate kinase [Corynebacterium amycolatum SK46]
 gi|213952467|gb|EEB63850.1| adenylate kinase [Corynebacterium amycolatum SK46]
          Length = 183

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 98/167 (58%), Gaps = 10/167 (5%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ +GPPG+GKGTQA  LS+KL VP +STGD+ RA +   T LG + K  +++G+L+ 
Sbjct: 1   MRLVLVGPPGAGKGTQAAILSEKLGVPHISTGDLFRANIGEGTPLGIEAKSYIDAGNLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +  ++V  R+   D   GF+LDG+PRTV QA+ L   +SN+   +DAV++  V +  +
Sbjct: 61  DDVTVRMVESRLNEDDAAKGFLLDGFPRTVGQAEELKRLLSNLGTELDAVVQFDVSEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRD 167
            +R+  R           R+DD  +V   R+  Y     PL  YY +
Sbjct: 121 VERMLAR----------GRADDTEEVIRNRMHVYTNETAPLLDYYSE 157


>gi|123966954|ref|YP_001012035.1| adenylate kinase [Prochlorococcus marinus str. MIT 9515]
 gi|166980349|sp|A2BYR7|KAD_PROM5 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|123201320|gb|ABM72928.1| Adenylate kinase [Prochlorococcus marinus str. MIT 9515]
          Length = 182

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 107/186 (57%), Gaps = 12/186 (6%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
            ++FLGPPG+GKGTQA  LS+  +   LSTG++LR E+D +T LGKQVK  M  G L+SD
Sbjct: 4   HLLFLGPPGAGKGTQAAYLSEANSYLHLSTGELLRKEIDLDTYLGKQVKDIMNKGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V ++V     L   + G+ILDGYPR + Q  SL+  + N++  ++ V  L V D  + 
Sbjct: 64  QLVLEIVNK--NLSKDNKGWILDGYPRNLSQVNSLNEVLMNINQPLEIVFYLDVPDEVLI 121

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+ +R           R DD  +    R++ Y++T  PL  YY+++  L  I+   D+ 
Sbjct: 122 KRLLLR----------GRKDDNEETIKTRLKIYKETTEPLIEYYKNLSLLEYINADGDLK 171

Query: 182 EVSRSI 187
            +S  I
Sbjct: 172 TISNDI 177


>gi|182418842|ref|ZP_02950107.1| adenylate kinase [Clostridium butyricum 5521]
 gi|237666398|ref|ZP_04526383.1| adenylate kinase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377339|gb|EDT74900.1| adenylate kinase [Clostridium butyricum 5521]
 gi|237657597|gb|EEP55152.1| adenylate kinase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 117/212 (55%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+I+ LGPPG+GKGTQA  +S K ++P +STGD+ R  +  NT LG + K  M++G L+ 
Sbjct: 1   MKIVLLGPPGAGKGTQAKSISNKYSIPHISTGDIFRKNISENTPLGVEAKSYMDNGQLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +   +V DR++  DC +G++LDG+PRTV QA++L++F+      +D  + ++V +  +
Sbjct: 61  DEVTINMVKDRLQQDDCRAGYLLDGFPRTVAQAEALNSFLIERGEQLDTALLIKVPNEFI 120

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R +                     +   SE   R DD  +   +R++ Y+K   
Sbjct: 121 LERMTGRRVCPSCGASYHVKFNPPSVEGKCDLCGSEVIQRKDDTVETVKERLDVYQKETQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  +Y +   L  +DG   ++EV R I  +L
Sbjct: 181 PLIDFYGNKQLLSEVDGTKAINEVFRGICEIL 212


>gi|149908130|ref|ZP_01896794.1| adenylate kinase(ATP-AMP transphosphorylase) [Moritella sp. PE36]
 gi|149808672|gb|EDM68605.1| adenylate kinase(ATP-AMP transphosphorylase) [Moritella sp. PE36]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +   VPQ+STGDMLRA +   + LG++VK  M+SG L+S
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMENYGVPQISTGDMLRAAIKEGSELGQKVKAVMDSGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++ ++V DR++  DC  GF+LDG+PRT+ QA ++    + +D  +D V+E  V D  +
Sbjct: 61  DGLIIELVKDRVKKEDCAKGFLLDGFPRTIPQADAMKE--NGID--VDFVLEFDVPDEEI 116

Query: 121 FKRIQVRVLEA---------------------IASEKSVRSDDKYDVFLKRIENYRKTIL 159
            KR+  R + A                        E ++R DD  +   KR+  Y     
Sbjct: 117 VKRMSGRRVHAPSGRVYHTVYNPPKVAGKDNETGDELTIRVDDVEETVRKRLGIYHDQTA 176

Query: 160 PLSSYY----RDMGCLYI-IDGMLDMDEVSRSIDSLL 191
           PL +YY          Y+  DG   +D VS+ +  LL
Sbjct: 177 PLIAYYGKEAEAGNSKYVTFDGTQTVDAVSKQLAELL 213


>gi|302344335|ref|YP_003808864.1| adenylate kinase [Desulfarculus baarsii DSM 2075]
 gi|301640948|gb|ADK86270.1| adenylate kinase [Desulfarculus baarsii DSM 2075]
          Length = 213

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 111/212 (52%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I LGPPG+GKGTQA +L     +PQ+STGDMLR  V   T LG + K  M++G L++
Sbjct: 1   MNLILLGPPGAGKGTQAKKLIDAYGIPQISTGDMLREAVKNQTPLGIEAKKFMDAGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D IV  +  DR+  PDC  GF+LDG+PRTV QA++L   ++ M+  ID V+ + V  + +
Sbjct: 61  DEIVIGLAKDRMAQPDCAKGFMLDGFPRTVPQAEALDKVLAEMNRKIDHVVSIEVPSSEL 120

Query: 121 FKRIQV-RVLEAIASEKSV--------------------RSDDKYDVFLKRIENYRKTIL 159
             R+   R  +A  S   V                    R DD       R++ Y     
Sbjct: 121 LGRLTGRRTCKACGSGFHVMFDPPKTEGKCDKCGGELYQRDDDNEATVSNRLKVYDDQTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G L  I G+  +D++   I ++L
Sbjct: 181 PLIDYYQQKGLLRPIQGVGSIDDIFGRIKAVL 212


>gi|292669837|ref|ZP_06603263.1| adenylate kinase [Selenomonas noxia ATCC 43541]
 gi|292648634|gb|EFF66606.1| adenylate kinase [Selenomonas noxia ATCC 43541]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 107/212 (50%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M II +GPPG+GKGTQA  L ++  +  +STGDM R  V   T LGK+ K  M++G L+ 
Sbjct: 1   MHIILMGPPGAGKGTQAANLVKRYGILHISTGDMFREAVKEGTPLGKEAKSYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           DA+   +V +R+  PDC  GFILDG+PRTV+QA +L   +++    +  V+ + V  A +
Sbjct: 61  DAVTVGIVRERLSKPDCRKGFILDGFPRTVEQADALDEILADNGIKLTGVVNINVPTADL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R   R                     V +        R+DD  +    R+  Y  +  
Sbjct: 121 IERAVGRRICKDCGHSFHVKFKPSKVEGVCDDCGGTTYQRADDSEETMKSRLSVYESSTR 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY+  G    IDG  D+ +V   + ++L
Sbjct: 181 PLIEYYKKAGVYKEIDGRQDIAKVEADLAAVL 212


>gi|172040035|ref|YP_001799749.1| adenylate kinase [Corynebacterium urealyticum DSM 7109]
 gi|238055692|sp|B1VEX6|KAD_CORU7 RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|171851339|emb|CAQ04315.1| adenylate kinase [Corynebacterium urealyticum DSM 7109]
          Length = 181

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 106/186 (56%), Gaps = 12/186 (6%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR++ LGPPG+GKGTQA  LS  LN+P +STGD+ RA + + T LGKQ +  M++G L+ 
Sbjct: 1   MRLVLLGPPGAGKGTQAQLLSDALNIPHISTGDLFRANISQGTELGKQAQEYMDAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
             +   +V  R+   D  +GF+LDG+PRT++QA  L   +   D  +DAVI  +V +  +
Sbjct: 61  TEVTANMVRARLEEADAANGFLLDGFPRTIEQADLLEEMLKEKDLKLDAVINYQVSEDVV 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
            +R+  R           R+DD       R++ YR+   PL  YY+  G +  ID    +
Sbjct: 121 VERMLSR----------GRNDDNESTIRTRLQVYREETAPLIDYYQ--GRILNIDAEGSV 168

Query: 181 DEVSRS 186
           +++S +
Sbjct: 169 EDISEA 174


>gi|300721958|ref|YP_003711238.1| adenylate kinase [Xenorhabdus nematophila ATCC 19061]
 gi|297628455|emb|CBJ89020.1| adenylate kinase [Xenorhabdus nematophila ATCC 19061]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 116/217 (53%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  +PQ+STGDMLRA V   + LG + K  M++G L++
Sbjct: 1   MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKAGSELGLKAKELMDNGKLVT 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V +RI+  DC +GF+LDG+PRT+ QA ++          +D+V+E  V D  +
Sbjct: 61  DELVIALVKERIKQDDCRNGFLLDGFPRTIPQADAM----KEAGIKVDSVLEFDVPDEII 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +RI  R +                     +A   E ++R DD+ D   KR+  Y     
Sbjct: 117 VERIIGRRVHAPSGRVYHIKFNPPKVENKDDATGEELTIRKDDQEDTVRKRLVEYHAQTA 176

Query: 160 PLSSYYRDMG-----CLYIIDGMLDMDEVSRSIDSLL 191
           PL SYY+          + +DG   + EVS  + S+L
Sbjct: 177 PLVSYYQKEAQEGNTQYFKLDGTRQVSEVSAELVSIL 213


>gi|260914169|ref|ZP_05920642.1| adenylate kinase [Pasteurella dagmatis ATCC 43325]
 gi|260631802|gb|EEX49980.1| adenylate kinase [Pasteurella dagmatis ATCC 43325]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 117/218 (53%), Gaps = 32/218 (14%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA  +  K  +PQ+STGDMLRA +   T LGKQ K  M++G L+ 
Sbjct: 1   MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMLRAAIKAGTELGKQAKTLMDAGQLLP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D ++  +V +R+   DC  GF+LDG+PRT+ QA +L          ID V+E  V D  +
Sbjct: 61  DDLIISLVKERVAQDDCVKGFLLDGFPRTIPQADAL----KTAGIQIDYVLEFDVPDEVI 116

Query: 121 FKRIQVRVLEAIASEKS----------------------VRSDDKYDVFLKRIENYRKTI 158
            +R+  R +   AS ++                      +R+DDK +  L R++ Y  T 
Sbjct: 117 VERMSGRRVHQ-ASGRTYHVVYNPPKVEGKDDVTGEDLIIRADDKPETVLDRLKVYHSTT 175

Query: 159 LPLSSYYRDMGC-----LYIIDGMLDMDEVSRSIDSLL 191
            PL  YY+          + +DG   ++EVS+ +DS+L
Sbjct: 176 KPLVDYYQAEANAGNTKYFRLDGTKKVEEVSQELDSIL 213


>gi|166031638|ref|ZP_02234467.1| hypothetical protein DORFOR_01338 [Dorea formicigenerans ATCC
           27755]
 gi|166028615|gb|EDR47372.1| hypothetical protein DORFOR_01338 [Dorea formicigenerans ATCC
           27755]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 119/212 (56%), Gaps = 21/212 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M+II LG PG+GKGTQA +++ K  +P +STGD+ RA +   T LGK+ K  M+ G L+ 
Sbjct: 1   MKIIMLGAPGAGKGTQAKKIAAKYEIPHISTGDIFRANIKEGTELGKKAKTYMDQGLLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  +V DR+   DC +G++LDG+PRT+ QA++L   ++ +   +D  I++ V D ++
Sbjct: 61  DELVVDLVVDRVNQEDCKNGYVLDGFPRTIPQAEALDKALAELGQKMDYAIDVDVPDENI 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             R+  R                     + +A   E  +R DDK +   KR++ Y +   
Sbjct: 121 IHRMGGRRACVGCGATYHLEYAPTKVEGICDACGKELILRDDDKPETVKKRLDVYHEQTQ 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
           PL  YY + G L  +DG +D+D V ++I  +L
Sbjct: 181 PLIDYYTNAGILKTVDGTVDIDVVFQNIVEIL 212


>gi|262277114|ref|ZP_06054907.1| adenylate kinase (ATP-AMP transphosphorylase) (AK) [alpha
           proteobacterium HIMB114]
 gi|262224217|gb|EEY74676.1| adenylate kinase (ATP-AMP transphosphorylase) (AK) [alpha
           proteobacterium HIMB114]
          Length = 218

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 115/215 (53%), Gaps = 24/215 (11%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M +I  GPPG+GKGTQ+  L +  N+ QLSTGD+LRAE+   + L KQ+K  M++G L+S
Sbjct: 1   MNLILFGPPGAGKGTQSSFLVESENMFQLSTGDLLRAELKSGSDLSKQLKEIMDAGKLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+N ++  +I  P   +  I DG+PR ++QAKSL   +   +  I A+I L+V+ + +
Sbjct: 61  DDIINNLIEKKISGPSVKNNIIFDGFPRNLEQAKSLDDMLDKYNQKISAIINLKVDYSVL 120

Query: 121 FKRIQVRVLEAI------------------------ASEKSVRSDDKYDVFLKRIENYRK 156
            KRI  RV  +I                        + E   RSDD       R++ Y  
Sbjct: 121 VKRISGRVSCSICKKPFNEFFDPPVEPNNCSNNKCDSRELIKRSDDNESTVTNRLKTYDD 180

Query: 157 TILPLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLL 191
             LP+  YYR  G +  +D M  ++EV+  I S++
Sbjct: 181 QTLPILDYYRKKGIVKDVDAMKAINEVTGEIKSII 215


>gi|323498441|ref|ZP_08103437.1| adenylate kinase [Vibrio sinaloensis DSM 21326]
 gi|323316514|gb|EGA69529.1| adenylate kinase [Vibrio sinaloensis DSM 21326]
          Length = 214

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 111/217 (51%), Gaps = 30/217 (13%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MRII LG PG+GKGTQA  + +K  VPQ+STGDMLRA +   T LGKQ K  +++G L+S
Sbjct: 1   MRIILLGAPGAGKGTQANFIMEKYGVPQISTGDMLRAAIKAGTELGKQAKAVIDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I+  ++ +RI   DC+ GF+LDG+PRT+ QA  L      M  A+D VIE  V D  +
Sbjct: 61  DEIILGLIKERIAQDDCEKGFLLDGFPRTIPQADGL----KEMGVAVDYVIEFDVADDVI 116

Query: 121 FKRIQVRVL---------------------EAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
            +R+  R                       +    +  VR DDK +    R+  Y +   
Sbjct: 117 VERMAGRRAHLPSGRTYHVVYNPPKVEGKDDVTGEDLVVRDDDKEETVRARLGVYHEQTA 176

Query: 160 PLSSYY----RDMGCLYI-IDGMLDMDEVSRSIDSLL 191
           PL SYY          Y+  DG   + EVS  I+  L
Sbjct: 177 PLISYYGKEAEAGNTKYLKFDGTKQVAEVSADIEKAL 213


>gi|223983941|ref|ZP_03634101.1| hypothetical protein HOLDEFILI_01382 [Holdemania filiformis DSM
           12042]
 gi|223964133|gb|EEF68485.1| hypothetical protein HOLDEFILI_01382 [Holdemania filiformis DSM
           12042]
          Length = 216

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 111/216 (51%), Gaps = 21/216 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ +GP GSGKGT + ++ +  N+P +STGDM RA +   T LGK+ +  M +G L+ 
Sbjct: 1   MNILIMGPAGSGKGTMSAKILESFNIPHISTGDMFRANIKEGTELGKKAQEYMNAGKLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D I   +V DR++ PDC +G++LDGYPRT+ QAK        +   ++ VI L VE  ++
Sbjct: 61  DEITVAMVADRLKQPDCQAGYLLDGYPRTLVQAKFFENLSKEIAKPVEVVINLVVEFEAL 120

Query: 121 FKRIQVR---------------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTIL 159
             RI  R                     + +   S    R+DD  +    R++ + K   
Sbjct: 121 ADRITGRRMCKNCGAIYHVRNHPSQVDGICDVCGSPLIQRADDTEEQLRVRLDEHEKNTK 180

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSIDSLLVSVR 195
           P+  YYR+ G +  I+    +DEV   + + L +V+
Sbjct: 181 PVLDYYREKGLVVDINATRSIDEVWNDVAAALENVK 216


>gi|45201283|ref|NP_986853.1| AGR187Wp [Ashbya gossypii ATCC 10895]
 gi|74691760|sp|Q74ZL1|KAD1_ASHGO RecName: Full=Adenylate kinase 1; Short=AK 1; AltName: Full=ATP-AMP
           transphosphorylase 1; AltName: Full=Adenylate kinase
           cytosolic and mitochondrial
 gi|44986137|gb|AAS54677.1| AGR187Wp [Ashbya gossypii ATCC 10895]
          Length = 277

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 109/199 (54%), Gaps = 24/199 (12%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R++ +GPPG+GKGTQA +L +K  V  L+TGDMLR++V + T LG Q K  M+ G L+S
Sbjct: 63  IRMVLIGPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQTALGVQAKKIMDQGGLVS 122

Query: 61  DAIVNQVVCDRIRL-PDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDAS 119
           D I+  ++ D +R  P+C +GFILDG+PRT+ QA+ L   +      +D  +EL+++D  
Sbjct: 123 DEIMVNMIKDELRSNPECANGFILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKIDDEL 182

Query: 120 MFKRIQVRVLEAIASEKSV----------------------RSDDKYDVFLKRIENYRKT 157
           +  RI  R++   AS +S                       RSDD  D   KR++ Y   
Sbjct: 183 LVARITGRLVHP-ASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAYHAQ 241

Query: 158 ILPLSSYYRDMGCLYIIDG 176
             P+  +Y+  G    +D 
Sbjct: 242 TEPIVDFYKKTGIWAGVDA 260


>gi|257065010|ref|YP_003144682.1| Adenylate kinase [Slackia heliotrinireducens DSM 20476]
 gi|256792663|gb|ACV23333.1| Adenylate kinase [Slackia heliotrinireducens DSM 20476]
          Length = 208

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 110/211 (52%), Gaps = 22/211 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M I+ LG PG+GKGTQA +L  +     +STGD+LRA V   T LGKQ K  M++G L+ 
Sbjct: 1   MNIVLLGAPGAGKGTQAAKLVAEYGTAHISTGDILRAAVRDQTELGKQAKAFMDAGDLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D+++  ++ +R++ PDC++GFILDG+PRT  QA +L A +S +   +DA + + V+   +
Sbjct: 61  DSLIIDLMNERLQQPDCETGFILDGFPRTTAQAVALDALLSEIKRPLDAALLVDVDPEVI 120

Query: 121 FKRIQVR---------------VLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYY 165
            KR+  R                      E   R DD       R++ Y K+  PL  YY
Sbjct: 121 VKRLSARRCCKDCGNIGTAADASCPKCGGEMYQRDDDNEATVRNRLDVYAKSTAPLVDYY 180

Query: 166 RDMGCLYIIDGMLDMDEVSRSIDSLLVSVRK 196
           R    L  +DG        R +D +   V+K
Sbjct: 181 RGKDLLISVDG-------DRPVDDVYADVKK 204


>gi|198282658|ref|YP_002218979.1| Nucleoside-triphosphate--adenylate kinase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|198247179|gb|ACH82772.1| Nucleoside-triphosphate--adenylate kinase [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 220

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 113/214 (52%), Gaps = 22/214 (10%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
             IFLG PG GKGTQA RL+Q + +P +STGDMLRA V   + +G +    MESG+L+ D
Sbjct: 6   HFIFLGAPGVGKGTQAQRLAQLIGLPHVSTGDMLRASVQSGSAIGVRAAAVMESGALVGD 65

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            I+  +V +R+ LPD  +G + DG+PRT+ QA +L   ++     I AV+ + + D  + 
Sbjct: 66  EIIIGIVAERLLLPDAATGVVFDGFPRTIHQANALDDLLAGRGDQIAAVLHIELADEEIV 125

Query: 122 KRIQVR-----------------VLEAI----ASEKSVRSDDKYDVFLKRIENYRKTILP 160
           +R+  R                  +E I          R DD+  V  KR+  Y+    P
Sbjct: 126 ERLSGRRVCATCGAIYHIRYHPPAVEGICDVCGGVLLQREDDQPAVIRKRLAVYQTETAP 185

Query: 161 LSSYYRDMGCLYIIDGMLDMDEV-SRSIDSLLVS 193
           L +YY D    +++ G  + DEV SR + ++ V+
Sbjct: 186 LIAYYHDRSAYHLVSGEGEADEVFSRIVKAVEVA 219


>gi|328677195|gb|AEB31320.1| hypothetical protein [Epinephelus bruneus]
          Length = 231

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 21/199 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA RL+++  V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPRLAEQYCVCHLATGDMLRAMVASGSELGKRLKETMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  V+D+ +
Sbjct: 78  DEMVVELIEKNLDTPACRNGFLLDGFPRTVKQAEMLDDLLDKRHEQLDSVIEFAVDDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      +  E  + RSDD       R+E Y +  +
Sbjct: 138 VRRICGRLIHQPSGRSYHEEFNPPKEPMKDDLTGEPLIRRSDDNEKTLKSRLEAYHRQTV 197

Query: 160 PLSSYYRDMGCLYIIDGML 178
           PL +YY+  G    ++  L
Sbjct: 198 PLVNYYKAKGLHTAVNAAL 216


>gi|160899004|ref|YP_001564586.1| adenylate kinase [Delftia acidovorans SPH-1]
 gi|226743871|sp|A9BWI1|KAD_DELAS RecName: Full=Adenylate kinase; Short=AK; AltName: Full=ATP-AMP
           transphosphorylase
 gi|160364588|gb|ABX36201.1| Nucleoside-triphosphate--adenylate kinase [Delftia acidovorans
           SPH-1]
          Length = 218

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 104/183 (56%), Gaps = 17/183 (9%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           M++I LG PG+GKGTQA  + QK  +PQ+STGDMLRA V   T LG+Q K  M++G L+S
Sbjct: 1   MKLILLGAPGAGKGTQAAFICQKYGIPQISTGDMLRAAVKAGTPLGQQAKAVMDAGQLVS 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHA------FISNMDCAIDAVIE-- 112
           D ++  +V +RI   DC +GF+ DG+PRT+ QA ++ A      ++  +D   DA+IE  
Sbjct: 61  DDLIINLVKERIAQADCANGFLFDGFPRTIPQADAMKAAGVKLDYVLEIDVPFDAIIERM 120

Query: 113 --LRVEDAS------MFKRIQVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILPLSS 163
              R   AS       F   +V   + +  E  V R DDK +   KR++ Y     PL  
Sbjct: 121 SGRRSHPASGRTYHVKFNPPKVEGQDDVTGEPLVQREDDKEETVKKRLDVYSSQTRPLVD 180

Query: 164 YYR 166
           YYR
Sbjct: 181 YYR 183


>gi|4760598|dbj|BAA77359.1| adenylate kinase isozyme 2 [Mus musculus]
          Length = 232

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + L K++K +M++G L+S
Sbjct: 16  IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELRKKLKATMDAGKLVS 75

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  ++D+ +
Sbjct: 76  DEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDELMEKRKEELDSVIEFSIQDSLL 135

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 136 IRRITGRLIRPKSGRFYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYYTQTT 195

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YYR  G    ID     D V  SI
Sbjct: 196 PLVEYYRKRGIHCAIDASQTPDIVFASI 223


>gi|221222210|gb|ACM09766.1| Adenylate kinase isoenzyme 2, mitochondrial [Salmo salar]
          Length = 244

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 110/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R I LGPPG+GKGTQA RL+++  V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  IRAILLGPPGAGKGTQAPRLAEQYCVCHLATGDMLRAMVASGSELGKRLKETMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C  GF+LDG+PRTV QA+ L   +      +D+VIE  V+D+ +
Sbjct: 78  DEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDDLLEKRTEKLDSVIEFSVDDSLL 137

Query: 121 FKRIQVRVLEAIASEKSV---------------------RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++   +                          RSDD       R+E Y +  +
Sbjct: 138 VRRICGRLIHQPSGRSYHDEFNPPKEPMKDDVTGQPLMRRSDDNASTLRSRLEAYHRQTV 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G    +D     D V  SI
Sbjct: 198 PLVKYYSARGLHKAVDAAQSPDVVFASI 225


>gi|27806929|ref|NP_776314.1| adenylate kinase 2, mitochondrial [Bos taurus]
 gi|162636|gb|AAA30365.1| adenylate kinase (EC 2.7.4.3) [Bos taurus]
 gi|217607|dbj|BAA14109.1| adenylate kinase 2B [Bos taurus]
 gi|86827743|gb|AAI12614.1| Adenylate kinase 2 [Bos taurus]
 gi|95769396|gb|ABF57432.1| adenylate kinase 2 [Bos taurus]
 gi|296490149|gb|DAA32262.1| adenylate kinase 2, mitochondrial [Bos taurus]
          Length = 234

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 109/208 (52%), Gaps = 21/208 (10%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           +R + LGPPG+GKGTQA +L++   V  L+TGDMLRA V   + LGK++K +M++G L+S
Sbjct: 18  VRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVS 77

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V +++   +  P C +GF+LDG+PRTV QA+ L   +      +D+VIE  + D+ +
Sbjct: 78  DEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL 137

Query: 121 FKRIQVRVLEA--------------------IASEKSV-RSDDKYDVFLKRIENYRKTIL 159
            +RI  R++                      I  E  + RSDD       R+E Y     
Sbjct: 138 IRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTT 197

Query: 160 PLSSYYRDMGCLYIIDGMLDMDEVSRSI 187
           PL  YY   G    ID     D V  SI
Sbjct: 198 PLVEYYSKRGIHSAIDASQTPDVVFASI 225


>gi|322515294|ref|ZP_08068291.1| adenylate kinase [Actinobacillus ureae ATCC 25976]
 gi|322118670|gb|EFX90882.1| adenylate kinase [Actinobacillus ureae ATCC 25976]
          Length = 241

 S