RPSBLAST alignment for GI: 254780240 and conserved domain: PRK13808

>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional. Length = 333
 Score =  199 bits (508), Expect = 4e-52
 Identities = 92/196 (46%), Positives = 127/196 (64%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           MR+I LGPPG+GKGTQA RL Q+  + QLSTGDMLRA V   T +G + K  M SG L+ 
Sbjct: 1   MRLILLGPPGAGKGTQAQRLVQQYGIVQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVP 60

Query: 61  DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120
           D +V  ++ DRI  PD  +GFILDG+PRTV QA++L A + +    +DAV+ELRV + ++
Sbjct: 61  DEVVVGIISDRIEQPDAANGFILDGFPRTVPQAEALDALLKDKQLKLDAVVELRVNEGAL 120

Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180
             R++ RV E  A  + VR+DD  +V  KR+ +YR    PL  YY +   L  +DGM+ +
Sbjct: 121 LARVETRVAEMRARGEEVRADDTPEVLAKRLASYRAQTEPLVHYYSEKRKLLTVDGMMTI 180

Query: 181 DEVSRSIDSLLVSVRK 196
           DEV+R I  +L +V  
Sbjct: 181 DEVTREIGRVLAAVGA 196