RPSBLAST alignment for GI: 254780240 and conserved domain: PRK14528

>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional. Length = 186
 Score =  164 bits (417), Expect = 1e-41
 Identities = 78/186 (41%), Positives = 115/186 (61%), Gaps = 6/186 (3%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
            IIF+GPPG+GKGTQA  L ++L++PQ+STGD+LR  V   T +G + K  M++G L+ D
Sbjct: 3   NIIFMGPPGAGKGTQAKILCERLSIPQISTGDILREAVKNQTAMGIEAKRYMDAGDLVPD 62

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           ++V  ++ DRIR  DC +GF+LDG+PRTV+QA +L A + N   +ID  I L V D  + 
Sbjct: 63  SVVIGIIKDRIREADCKNGFLLDGFPRTVEQADALDALLKNEGKSIDKAINLEVPDGELL 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           KR+  R      +E   R+DD       R++NY K  LPL  +Y     L  ++G+  ++
Sbjct: 123 KRLLGR------AEIEGRADDNEATIKNRLDNYNKKTLPLLDFYAAQKKLSQVNGVGSLE 176

Query: 182 EVSRSI 187
           EV+  I
Sbjct: 177 EVTSLI 182