RPSBLAST alignment for GI: 254780240 and conserved domain: PRK14531

>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional. Length = 183
 Score =  139 bits (351), Expect = 6e-34
 Identities = 69/190 (36%), Positives = 112/190 (58%), Gaps = 11/190 (5%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R++FLGPPG+GKGTQA RL     +  LSTGD+LR+EV   + LG++ +  M  G L+SD
Sbjct: 4   RLLFLGPPGAGKGTQAARLCAAHGLRHLSTGDLLRSEVAAGSALGQEAEAVMNRGELVSD 63

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
           A+V  +V  +++  +   G++LDG+PRTV QA++L   +  +   I+AV+ L ++DA + 
Sbjct: 64  ALVLAIVESQLKALNSG-GWLLDGFPRTVAQAEALEPLLEELKQPIEAVVLLELDDAVLI 122

Query: 122 KRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDMD 181
           +R+  R           R+DD   V   R+E YR+   PL  +YR  G L  ++    ++
Sbjct: 123 ERLLAR----------GRADDNEAVIRNRLEVYREKTAPLIDHYRQRGLLQSVEAQGSIE 172

Query: 182 EVSRSIDSLL 191
            ++  I+ +L
Sbjct: 173 AITERIEKVL 182