RPSBLAST alignment for GI: 254780240 and conserved domain: PTZ00088

>gnl|CDD|173382 PTZ00088, PTZ00088, adenylate kinase 1; Provisional. Length = 229
 Score =  104 bits (262), Expect = 1e-23
 Identities = 61/224 (27%), Positives = 101/224 (45%), Gaps = 42/224 (18%)

Query: 1   MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60
           ++I+  G PG GKGT A  LS+K N+  ++ G++LR E+   T +GK+++  + SG+L+ 
Sbjct: 7   LKIVLFGAPGVGKGTFAEILSKKENLKHINMGNILREEIKAKTTIGKEIQKVVTSGNLVP 66

Query: 61  DAIVNQVVCDRIR--LPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDA 118
           D +V  +V D I     DC  GFILDG+PR + Q K L    +     ID  + + +   
Sbjct: 67  DNLVIAIVKDEIAKVTDDCFKGFILDGFPRNLKQCKELGKITN-----IDLFVNIYLPRN 121

Query: 119 SMFKRIQVR------------------------VLEAIASEKS-------VRSDDKYDVF 147
            + K++  R                        +L     E          RSDD  ++ 
Sbjct: 122 ILIKKLLGRRICNTCNRNFNIAHIRSDPYDMPPILPPADCEGCKGNPKLQKRSDDTEEIV 181

Query: 148 LKRIENYRKTILPLSSYYRDMGC----LYIIDGMLDMDEVSRSI 187
             R+  Y  T  P+  ++++  C      I  G+ D D+  R +
Sbjct: 182 AHRLNTYESTNSPIIQFFKNENCNLVDFEITRGLRDFDDFYRIV 225