RPSBLAST alignment for GI: 254780240 and conserved domain: PLN02674

>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase. Length = 244
 Score =  117 bits (295), Expect = 2e-27
 Identities = 66/191 (34%), Positives = 101/191 (52%), Gaps = 21/191 (10%)

Query: 2   RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLISD 61
           R+I +GPPGSGKGTQ+  +  +  +  L+TGDMLRA V   T LG + K +M+ G L+SD
Sbjct: 33  RLILIGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSD 92

Query: 62  AIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMF 121
            +V  ++ + ++ P C  GFILDG+PRTV QA+ L   ++     ID V+   ++DA + 
Sbjct: 93  DLVVGIIDEAMKKPSCQKGFILDGFPRTVVQAQKLDEMLAKQGAKIDKVLNFAIDDAILE 152

Query: 122 KRI--------------------QVRVLEAIASEKSV-RSDDKYDVFLKRIENYRKTILP 160
           +RI                    +V  ++ +  E  + R DD   V   R+E + K   P
Sbjct: 153 ERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEP 212

Query: 161 LSSYYRDMGCL 171
           +  YY   G +
Sbjct: 213 VIDYYAKKGVV 223