HHsearch alignment for GI: 254780243 and conserved domain: COG1841

>COG1841 RpmD Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis].
Probab=99.80  E-value=7.5e-20  Score=127.03  Aligned_cols=55  Identities=49%  Similarity=0.752  Sum_probs=53.9

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC
Q ss_conf             5999973368989899999998383467982898299789707986211147839
Q gi|254780243|r   10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE   64 (64)
Q Consensus        10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE   64 (64)
T Consensus         1 ~~V~~iRs~ig~~~~~r~tl~~LgL~kin~~v~~~dtp~irGMi~kV~~lV~v~e   55 (55)
T COG1841           1 LKVTLIRSPIGRPPKIRKTLRLLGLRKINHTVIVEDTPAVRGMLNKVKHLVTVGE   55 (55)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEECC
T ss_conf             9699972467998689999998298733778997598789999998775568449