Query gi|254780243|ref|YP_003064656.1| 50S ribosomal protein L30 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 64 No_of_seqs 107 out of 803 Neff 4.7 Searched_HMMs 39220 Date Tue May 24 01:15:03 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780243.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK05611 rpmD 50S ribosomal pr 99.9 4.3E-25 1.1E-29 155.0 7.6 58 7-64 1-58 (58) 2 TIGR01308 rpmD_bact ribosomal 99.9 1.6E-25 4.2E-30 157.3 4.7 55 10-64 1-55 (55) 3 cd01658 Ribosomal_L30 Ribosoma 99.9 6.6E-23 1.7E-27 143.4 6.8 54 10-63 1-54 (54) 4 COG1841 RpmD Ribosomal protein 99.8 7.5E-20 1.9E-24 127.0 6.8 55 10-64 1-55 (55) 5 cd00355 Ribosomal_L30_like Rib 99.8 1.2E-18 3E-23 120.7 6.3 53 11-63 1-53 (53) 6 pfam00327 Ribosomal_L30 Riboso 99.7 1.3E-17 3.2E-22 115.1 6.4 52 9-60 1-52 (52) 7 PRK06049 rpl30p 50S ribosomal 99.0 2.2E-09 5.7E-14 71.0 6.9 54 10-63 3-56 (155) 8 TIGR01309 L30P_arch ribosomal 98.9 8.3E-10 2.1E-14 73.3 3.9 55 10-64 1-56 (160) 9 KOG4799 consensus 98.7 2.2E-08 5.7E-13 65.7 5.6 56 8-63 58-114 (182) 10 cd01657 Ribosomal_L7_archeal_e 98.7 6.2E-08 1.6E-12 63.3 6.9 54 10-63 2-55 (159) 11 TIGR01310 L7 60S ribosomal pro 95.5 0.014 3.5E-07 34.7 3.3 53 8-60 80-132 (248) 12 KOG3184 consensus 76.9 3.5 9E-05 21.9 3.7 53 8-60 74-126 (235) 13 PRK09358 adenosine deaminase; 28.4 56 0.0014 15.5 4.9 49 7-55 188-236 (333) 14 pfam10059 consensus 20.7 42 0.0011 16.1 0.9 27 30-56 52-78 (119) 15 pfam04551 GcpE GcpE protein. I 20.3 81 0.0021 14.6 2.5 34 8-41 223-256 (345) No 1 >PRK05611 rpmD 50S ribosomal protein L30; Reviewed Probab=99.92 E-value=4.3e-25 Score=155.03 Aligned_cols=58 Identities=47% Similarity=0.718 Sum_probs=57.2 Q ss_pred CCEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC Q ss_conf 2625999973368989899999998383467982898299789707986211147839 Q gi|254780243|r 7 MQKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 (64) Q Consensus 7 ~~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE 64 (64) |++++|||+||+||++++|++|++||||+|+|++|+++|||++||||++|+|||+||| T Consensus 1 M~~lkItlvkS~ig~~~~qr~tl~aLGL~ki~~~v~~~dtp~irGmi~kV~hLV~VEE 58 (58) T PRK05611 1 MKTIKITLVKSLIGRKPKQRATLKGLGLRKINSTVELEDTPAIRGMINKVSHLVKVEE 58 (58) T ss_pred CCEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC T ss_conf 9807999950678999899999998199989998894899789879996254269849 No 2 >TIGR01308 rpmD_bact ribosomal protein L30; InterPro: IPR005996 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Ribosomal protein L30 is one of the proteins from the large ribosomal subunit. L30 belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups bacteria and archaea L30, yeast mitochondrial L33, and Drosophila, slime mould, fungal and mammalian L7 ribosomal proteins. L30 from bacteria are small proteins of about 60 residues. This model describes bacterial, chlorplast and mitochondrial forms of ribosomal protein L30.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit. Probab=99.91 E-value=1.6e-25 Score=157.26 Aligned_cols=55 Identities=49% Similarity=0.773 Sum_probs=54.2 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC Q ss_conf 5999973368989899999998383467982898299789707986211147839 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE 64 (64) |+|||+||+||+|+.||+||+||||+|+|++++++|||||||||++|+|||+||| T Consensus 1 ikvtlVrS~IG~~~~qr~tL~aLGL~k~~~~v~~~~~paIrGM~~~V~hLv~Ve~ 55 (55) T TIGR01308 1 IKVTLVRSLIGRPKKQRKTLKALGLRKIGKQVVLEDTPAIRGMVNKVKHLVKVEE 55 (55) T ss_pred CEEEEECCCCCCCHHHHHHHHCCCCCCCCCEEEECCCHHHHCCHHHHHEEEEEEC T ss_conf 9577714888873012464200588876987787369478301642001233408 No 3 >cd01658 Ribosomal_L30 Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea. Probab=99.88 E-value=6.6e-23 Score=143.36 Aligned_cols=54 Identities=46% Similarity=0.724 Sum_probs=53.2 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 599997336898989999999838346798289829978970798621114783 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) ++|||+||+||++++||+|++||||+|+||+++++|||++||||++|+|||+|| T Consensus 1 lkItlvrS~ig~~~~~r~tl~~LGL~k~~~~v~~~dtp~irGmi~kV~hLV~VE 54 (54) T cd01658 1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54 (54) T ss_pred CEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEC T ss_conf 959997068998989999999939997999889579978988999644646759 No 4 >COG1841 RpmD Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis] Probab=99.80 E-value=7.5e-20 Score=127.03 Aligned_cols=55 Identities=49% Similarity=0.752 Sum_probs=53.9 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC Q ss_conf 5999973368989899999998383467982898299789707986211147839 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE 64 (64) ++|+|+||+||+|++|++|+++|||+|+|++|+++|||+++|||++|+|||+|+| T Consensus 1 ~~V~~iRs~ig~~~~~r~tl~~LgL~kin~~v~~~dtp~irGMi~kV~~lV~v~e 55 (55) T COG1841 1 LKVTLIRSPIGRPPKIRKTLRLLGLRKINHTVIVEDTPAVRGMLNKVKHLVTVGE 55 (55) T ss_pred CEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEECC T ss_conf 9699972467998689999998298733778997598789999998775568449 No 5 >cd00355 Ribosomal_L30_like Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea. Probab=99.76 E-value=1.2e-18 Score=120.66 Aligned_cols=53 Identities=47% Similarity=0.725 Sum_probs=51.9 Q ss_pred EEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 99997336898989999999838346798289829978970798621114783 Q gi|254780243|r 11 TVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 11 kItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) +|||+||.+|++++|++|+++|||+|+|++|+++|||+++|||++|+|||+|| T Consensus 1 ~I~~irs~ig~~~~~r~tl~~LgL~k~~~~v~~~~tp~~~Gmi~kV~hlV~v~ 53 (53) T cd00355 1 KVTRVRSLIGRPPKQRKTLKALGLRKINQTVFVKDTPSIRGMLRKVKHLVTVG 53 (53) T ss_pred CEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEC T ss_conf 96898088998989999999929982898689679988999999524436869 No 6 >pfam00327 Ribosomal_L30 Ribosomal protein L30p/L7e. This family includes prokaryotic L30 and eukaryotic L7. Probab=99.71 E-value=1.3e-17 Score=115.11 Aligned_cols=52 Identities=44% Similarity=0.696 Sum_probs=50.5 Q ss_pred EEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHE Q ss_conf 2599997336898989999999838346798289829978970798621114 Q gi|254780243|r 9 KITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 (64) Q Consensus 9 ~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV 60 (64) .++|+|+||.+|.+++|++|+++|||+|+|++|+++|||+++|||++|+||| T Consensus 1 ~l~V~~irs~ig~~~~~~~tl~~LgL~ki~~~v~~~~tp~~~Gmi~kV~~lV 52 (52) T pfam00327 1 LLKITRIRSIIGRPPKQKKTLKLLGLRKINQTVFVKDTPAIRGMLRKVKHLV 52 (52) T ss_pred CEEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHCC T ss_conf 9579997267898989999999819995899789649989998999766329 No 7 >PRK06049 rpl30p 50S ribosomal protein L30P; Reviewed Probab=98.95 E-value=2.2e-09 Score=71.03 Aligned_cols=54 Identities=28% Similarity=0.434 Sum_probs=51.0 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 599997336898989999999838346798289829978970798621114783 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) +-|-++||.+|.++++++|++.|+|+++|++|+.++||+++||+++|++-|..- T Consensus 3 ~~VIRiRG~~~v~~~i~~tL~lLrL~~in~~v~v~~~~~~~gML~~V~~YVtwG 56 (155) T PRK06049 3 YAVIRIRGRVDVPPDIADTLKMLRLHRVNHCVLVPETPSYKGMLQKVKDYVTWG 56 (155) T ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCCEEEEE T ss_conf 899996468997978999999828872322789858888998998616635776 No 8 >TIGR01309 L30P_arch ribosomal protein L30P; InterPro: IPR005997 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Ribosomal protein L30 is one of the proteins from the large ribosomal subunit. L30 belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups bacteria and archaea L30, yeast mitochondrial L33, and Drosophila, slime mould, fungal and mammalian L7 ribosomal proteins This model describes archaeal 50S ribosomal protein L30. These proteins share similarity to the longer eukaryotic 60S ribosomal protein L7 and to the much shorter (~60 residue) bacterial 50S ribosomal protein L30. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit. Probab=98.93 E-value=8.3e-10 Score=73.34 Aligned_cols=55 Identities=27% Similarity=0.463 Sum_probs=50.5 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCC-HHHHHHHHHHHHHEEEEC Q ss_conf 5999973368989899999998383467982898299-789707986211147839 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDT-PSVRGMISTVHHLVRIVE 64 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dt-P~irGmi~kV~hLV~VeE 64 (64) +-|-++|+..|.++...+|++.|.|+++|++++.||| |+++||++||+--|..=| T Consensus 1 ~AviRiRG~v~v~rdI~dTL~mLRL~~~nh~v~~p~tl~~~~GML~kV~dYvTwGE 56 (160) T TIGR01309 1 LAVIRIRGTVDVPRDIADTLEMLRLHRVNHCVLVPETLPTYKGMLQKVKDYVTWGE 56 (160) T ss_pred CCEEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCHHHHHHHHCCCCCEEEECC T ss_conf 90588722658960668899873000012035630663443302010366545357 No 9 >KOG4799 consensus Probab=98.72 E-value=2.2e-08 Score=65.70 Aligned_cols=56 Identities=32% Similarity=0.495 Sum_probs=50.4 Q ss_pred CEEEEEEEECCCCCCHHHHHHHHHHCCCCCC-CEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 6259999733689898999999983834679-8289829978970798621114783 Q gi|254780243|r 8 QKITVQQIGSPIRRPSVQRKVLIGLGLNKMN-RCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 8 ~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~-~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) +-..++++||+-++|+|.++.++.|||.+-+ ..-+++|+|+++..+++|+||+++. T Consensus 58 KL~~v~rik~t~~~PyWek~iik~lGld~k~t~~qV~kNip~vNakLwkIKHLI~~~ 114 (182) T KOG4799 58 KLHIVTRIKSTRRRPYWEKDIIKMLGLDKKHTRPQVHKNIPSVNAKLWKIKHLIRLR 114 (182) T ss_pred CEEEEEEECCCCCCCCHHHHHHHHHCCCCCCCCCEEEECCHHHHHHHHHHHHEEEEE T ss_conf 346788640566786228889998374434477367605510206888743315766 No 10 >cd01657 Ribosomal_L7_archeal_euk Ribosomal protein L7, which is found in archaea and eukaryotes but not in prokaryotes, binds domain II of the 23S rRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L7 members have an N-terminal extension not found in the archeal L7 orthologs. L7 is closely related to the ribosomal L30 protein found in eukaryotes and prokaryotes. Probab=98.68 E-value=6.2e-08 Score=63.33 Aligned_cols=54 Identities=26% Similarity=0.267 Sum_probs=50.6 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 599997336898989999999838346798289829978970798621114783 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) +-|-++||..|.+++.++|++-|+|+++|+.|+.++||++.||+++|++-|.+- T Consensus 2 ~~VIRirG~~~v~~~v~~tL~lLrL~~~n~~vfv~~~~~~~~ML~~v~pYVt~G 55 (159) T cd01657 2 YAVVRIRGIVGVPPKIRKTLQLLRLRRINNAVFVKLTKATIGMLKKVEPYVTWG 55 (159) T ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCCEEEEE T ss_conf 799997278998978999999818985243799978888999998417647886 No 11 >TIGR01310 L7 60S ribosomal protein L7; InterPro: IPR005998 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Eukaryotic ribosomal protein, L7, contains an N-terminal bZIP DNA binding domain and a second, DNA-binding domain has been mapped to the 50 C-terminal amino acids of the protein . In addition to its role in translation, L7 has also been shown to be involved in nuclear-receptor mediated transcriptional control. There is no bacterial homologue of this protein. ; GO: 0003735 structural constituent of ribosome, 0030528 transcription regulator activity, 0006412 translation, 0015934 large ribosomal subunit. Probab=95.51 E-value=0.014 Score=34.75 Aligned_cols=53 Identities=25% Similarity=0.211 Sum_probs=48.0 Q ss_pred CEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHE Q ss_conf 62599997336898989999999838346798289829978970798621114 Q gi|254780243|r 8 QKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 (64) Q Consensus 8 ~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV 60 (64) +-+-|-.+++.-+.+|+.|++++-|+|.++|.-|..+.|+++.-|++.|.=-| T Consensus 80 kl~FViR~~Gin~~~PK~rk~L~~LRL~~~~nGVFvK~nK~~~~~Lr~vEPYV 132 (248) T TIGR01310 80 KLLFVIRIKGINGLPPKPRKVLRLLRLKQVNNGVFVKVNKATLEMLRIVEPYV 132 (248) T ss_pred CEEEEEEECCCCCCCCCHHHHHHHCCCCCCCCEEEEEECHHHHHHCCEECCEE T ss_conf 74899861360788886699997504211120243666567785132015647 No 12 >KOG3184 consensus Probab=76.89 E-value=3.5 Score=21.87 Aligned_cols=53 Identities=19% Similarity=0.124 Sum_probs=47.3 Q ss_pred CEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHE Q ss_conf 62599997336898989999999838346798289829978970798621114 Q gi|254780243|r 8 QKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 (64) Q Consensus 8 ~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV 60 (64) +...|-.+++..|.+++.++++.=|-|+.++..+....|++...|+.-|.--| T Consensus 74 ~l~fvvri~gin~v~pk~~k~l~lLrL~~If~g~fVKlnk~~~~mLriVepYV 126 (235) T KOG3184 74 KLAFVIRIRGVNGVEPKSRKVLQLLRLKQIFNGTFVKLNKATVNMLRIVEPYI 126 (235) T ss_pred CCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHCCCHH T ss_conf 32225620335665741789999987632455416885264665671204300 No 13 >PRK09358 adenosine deaminase; Provisional Probab=28.37 E-value=56 Score=15.46 Aligned_cols=49 Identities=10% Similarity=0.138 Sum_probs=40.8 Q ss_pred CCEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHH Q ss_conf 2625999973368989899999998383467982898299789707986 Q gi|254780243|r 7 MQKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMIST 55 (64) Q Consensus 7 ~~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~k 55 (64) ...+++|..-+=.+.+...+.++..||-.|+|+-+-.-+.|..--.+.+ T Consensus 188 ~~gl~~t~HaGE~~~~~~i~~ai~~l~a~RIGHGv~~~~d~~l~~~l~~ 236 (333) T PRK09358 188 DAGLRLTAHAGEAGGPESIWEALDELGADRIGHGVRAIEDPALMDRLAD 236 (333) T ss_pred HCCCCEEEECCCCCCHHHHHHHHHHCCCCEECCCEECCCCHHHHHHHHH T ss_conf 8599233306888984999999984287642350311679999999986 No 14 >pfam10059 consensus Probab=20.71 E-value=42 Score=16.12 Aligned_cols=27 Identities=30% Similarity=0.410 Sum_probs=23.1 Q ss_pred HHHCCCCCCCEEEECCCHHHHHHHHHH Q ss_conf 983834679828982997897079862 Q gi|254780243|r 30 IGLGLNKMNRCRVLDDTPSVRGMISTV 56 (64) Q Consensus 30 ~~LGL~k~~~~v~~~dtP~irGmi~kV 56 (64) ..||++|.+++.+.-|||..|-..+++ T Consensus 52 ~~lG~~R~g~~keq~d~p~~R~~cr~l 78 (119) T pfam10059 52 IYLGINRWGMTKEQYDTPEYRRFCREL 78 (119) T ss_pred HHCCCCCCCCCHHHHCCHHHHHHHHHH T ss_conf 532789897378871686899999999 No 15 >pfam04551 GcpE GcpE protein. In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway. Probab=20.26 E-value=81 Score=14.58 Aligned_cols=34 Identities=26% Similarity=0.314 Sum_probs=22.3 Q ss_pred CEEEEEEEECCCCCCHHHHHHHHHHCCCCCCCEE Q ss_conf 6259999733689898999999983834679828 Q gi|254780243|r 8 QKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCR 41 (64) Q Consensus 8 ~~ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v 41 (64) .+|+|.|--.+.-.-+--+..|++||||+.+-.+ T Consensus 223 DTIRVSLt~dP~~EV~v~~~IL~sl~lR~~g~~i 256 (345) T pfam04551 223 DTIRVSLTEDPVEEVKVAFEILQSLGLRKRGVEI 256 (345) T ss_pred CEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCEE T ss_conf 5399967899547899999999972877578648 Done!