HHsearch results for GI: 254780243 and protein with PDBid: 1vq8_W

>1vq8_W 50S ribosomal protein L30P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.59.1.1 PDB: 1jj2_V 1k73_X* 1k8a_X* 1k9m_X* 1kc8_X* 1kd1_X* 1kqs_V* 1m1k_X* 1m90_X* 1n8r_X* 1nji_X* 1q7y_X* 1q81_X* 1q82_X* 1q86_X* 1qvf_V 1qvg_V 1s72_W* 1vq4_W* 1vq5_W* ...
Probab=99.62  E-value=7.3e-16  Score=104.53  Aligned_cols=55  Identities=22%  Similarity=0.395  Sum_probs=53.6

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC
Q ss_conf             5999973368989899999998383467982898299789707986211147839
Q gi|254780243|r   10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE   64 (64)
Q Consensus        10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE   64 (64)
                      +.|+++||.+|.+++|++|+++|||+|+|++|+++|||+++|||++|+|+|.+.|
T Consensus         2 ~aVirIRg~ig~~~~~r~tL~~LgL~ki~~~V~~~~tp~~~gML~kV~~yVt~Ge   56 (154)
T 1vq8_W            2 HALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGE   56 (154)
T ss_dssp             EEEEECSCSTTSCHHHHHHHHHTTCCSTTEEEEECCCHHHHHHHHHSGGGEEEEC
T ss_pred             EEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHCCCEEEEC
T ss_conf             4699815878989899999998399857987897189899999986254424634