HHSEARCH alignment of GI: 254780243 and SCOP domain: d1vqow1

Alignment
>d1vqow1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
Probab=99.50  E-value=2e-14  Score=95.60  Aligned_cols=55  Identities=22%  Similarity=0.395  Sum_probs=53.2

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEEC
Q ss_conf             5999973368989899999998383467982898299789707986211147839
Q gi|254780243|r   10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE   64 (64)
Q Consensus        10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~VeE   64 (64)
                      +.|+++||.+|.++++++|+++|||+++|++|+++|||+++|||++|+|+|.+.|
T Consensus         2 ~aViRIRg~ig~~~~~r~tL~~LrL~k~~~~V~~~~tp~~~gML~kVk~yVt~G~   56 (154)
T d1vqow1           2 HALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGE   56 (154)
T ss_dssp             EEEEECSCSTTSCHHHHHHHHHTTCCSTTEEEEECCCHHHHHHHHHSTTSEEEEC
T ss_pred             EEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHCCCEEEEC
T ss_conf             4699826878989899999998399868987893389899999875066346763


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L30p/L7e
superfamily: Ribosomal protein L30p/L7e
family: Ribosomal protein L30p/L7e
domain: Archaeal L30 (L30a)
species: Archaeon Haloarcula marismortui [TaxId: 2238]