RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780243|ref|YP_003064656.1| 50S ribosomal protein L30 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >gnl|CDD|100100 cd01658, Ribosomal_L30, Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.. Length = 54 Score = 66.3 bits (163), Expect = 2e-12 Identities = 25/54 (46%), Positives = 34/54 (62%) Query: 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 + + + S I RP QR L LGL K+N+ V DTPS+RGMI+ V HLV++ Sbjct: 1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54 >gnl|CDD|32026 COG1841, RpmD, Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis]. Length = 55 Score = 60.1 bits (146), Expect = 1e-10 Identities = 27/55 (49%), Positives = 36/55 (65%) Query: 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 + V I SPI RP RK L LGL K+N +++DTP+VRGM++ V HLV + E Sbjct: 1 LKVTLIRSPIGRPPKIRKTLRLLGLRKINHTVIVEDTPAVRGMLNKVKHLVTVGE 55 >gnl|CDD|100098 cd00355, Ribosomal_L30_like, Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.. Length = 53 Score = 58.2 bits (142), Expect = 5e-10 Identities = 25/51 (49%), Positives = 33/51 (64%) Query: 12 VQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRI 62 V ++ S I RP QRK L LGL K+N+ + DTPS+RGM+ V HLV + Sbjct: 2 VTRVRSLIGRPPKQRKTLKALGLRKINQTVFVKDTPSIRGMLRKVKHLVTV 52 >gnl|CDD|144060 pfam00327, Ribosomal_L30, Ribosomal protein L30p/L7e. This family includes prokaryotic L30 and eukaryotic L7. Length = 52 Score = 57.5 bits (140), Expect = 7e-10 Identities = 23/52 (44%), Positives = 33/52 (63%) Query: 9 KITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 + + +I S I RP Q+K L LGL K+N+ + DTP++RGM+ V HLV Sbjct: 1 LLKITRIRSIIGRPPKQKKTLKLLGLRKINQTVFVKDTPAIRGMLRKVKHLV 52 >gnl|CDD|100099 cd01657, Ribosomal_L7_archeal_euk, Ribosomal protein L7, which is found in archaea and eukaryotes but not in prokaryotes, binds domain II of the 23S rRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L7 members have an N-terminal extension not found in the archeal L7 orthologs. L7 is closely related to the ribosomal L30 protein found in eukaryotes and prokaryotes.. Length = 159 Score = 31.3 bits (72), Expect = 0.051 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 26 RKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 RK L L L ++N + T + GM+ V V Sbjct: 18 RKTLQLLRLRRINNAVFVKLTKATIGMLKKVEPYV 52 >gnl|CDD|39996 KOG4799, KOG4799, KOG4799, Mitochondrial ribosomal protein L30 [Translation, ribosomal structure and biogenesis]. Length = 182 Score = 30.1 bits (67), Expect = 0.13 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Query: 12 VQQIGSPIRRPSVQRKVLIGLGLN-KMNRCRVLDDTPSVRGMISTVHHLVRIV 63 V +I S RRP ++ ++ LGL+ K R +V + PSV + + HL+R+ Sbjct: 62 VTRIKSTRRRPYWEKDIIKMLGLDKKHTRPQVHKNIPSVNAKLWKIKHLIRLR 114 >gnl|CDD|37701 KOG2490, KOG2490, KOG2490, Predicted membrane protein [Function unknown]. Length = 601 Score = 25.7 bits (56), Expect = 2.9 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 1 MSSSLKMQKITVQQIGSPIRRPSVQR 26 +SSS+ ++KI ++ I+ S + Sbjct: 158 VSSSILLRKIDTSRLYHIIKSQSFIK 183 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.136 0.377 Gapped Lambda K H 0.267 0.0869 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 706,182 Number of extensions: 26503 Number of successful extensions: 57 Number of sequences better than 10.0: 1 Number of HSP's gapped: 57 Number of HSP's successfully gapped: 7 Length of query: 64 Length of database: 6,263,737 Length adjustment: 36 Effective length of query: 28 Effective length of database: 5,485,813 Effective search space: 153602764 Effective search space used: 153602764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 51 (23.2 bits)