PSIBLAST alignment of GI: 254780244 and protein with PDB id: 1i94

>gi|14278534|pdb|1I94|E Chain E, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 161
>gi|14278555|pdb|1I95|E Chain E, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine Length = 161
 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/151 (41%), Positives = 87/151 (57%), Gaps = 1/151 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           +    ++++ I R +    GGRRF F  LVVVGD + +VG     A EVP AV+KA   A
Sbjct: 2   ETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYA 61

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           +RNM+ V L +  T+ H+     GA K++++ A  GTGVIAG   RA+ E+ G+ D++ K
Sbjct: 62  RRNMVEVPLQN-GTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTK 120

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRR 169
            +GS NP N+  AT E LR      DV   R
Sbjct: 121 ELGSRNPINIAYATMEALRQLRTKADVERLR 151