RPSBLAST alignment of GI: 254780244 and MMDB domain: 2zkq_e_82-179

>2zkq_e (e:82-179) 40S ribosomal protein S2E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 98
 Score = 90.6 bits (225), Expect = 1e-19
 Identities = 19/87 (21%), Positives = 34/87 (39%), Gaps = 4/87 (4%)

Query: 90  GRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP-HNV 148
             T+     GR G+  V +  A  GTG+++    + +  + G+ D    + G +    N 
Sbjct: 4   PHTVPCKVTGRSGSVPVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNF 63

Query: 149 IRATFEVLR---SQSHPRDVANRRGIK 172
            +ATF+ +    S   P         K
Sbjct: 64  AKATFDAISKTYSYLTPDLWKETVFTK 90