BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780246|ref|YP_003064659.1| 50S ribosomal protein L6 [Candidatus Liberibacter asiaticus str. psy62] (177 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780246|ref|YP_003064659.1| 50S ribosomal protein L6 [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 358 bits (920), Expect = e-101, Method: Compositional matrix adjust. Identities = 177/177 (100%), Positives = 177/177 (100%) Query: 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKK 60 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKK Sbjct: 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKK 60 Query: 61 ARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEG 120 ARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEG Sbjct: 61 ARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEG 120 Query: 121 ISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177 ISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK Sbjct: 121 ISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVIIRKEGKKK 177 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 25.8 bits (55), Expect = 0.44, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 19/40 (47%) Query: 19 VEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGS 58 +EDH IK GP + +M D I+ L + + GS Sbjct: 95 LEDHHIKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGS 134 >gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 23.1 bits (48), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 117 PLEGISIFVSKPTEIIVSG 135 P+E +S+FV P +I G Sbjct: 12 PIESVSLFVDMPYSVIKDG 30 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.381 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 108,652 Number of Sequences: 1233 Number of extensions: 4271 Number of successful extensions: 11 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 4 length of query: 177 length of database: 328,796 effective HSP length: 68 effective length of query: 109 effective length of database: 244,952 effective search space: 26699768 effective search space used: 26699768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)