RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (N:) Length = 100 Score = 105 bits (264), Expect = 2e-24 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 1/101 (0%) Query: 1 MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60 MA+ S ++R K+R + K R + K+ + + +L ++++ +L S PR+ + R+ Sbjct: 1 MARKSLIQREKKRRNLEQKYHLIRRSSKQEIRKVT-SLSDKWEIHGKLQSPPRNSAPARL 59 Query: 61 RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 RC ++GR R RDF LS LRE+ +PG +SSW Sbjct: 60 HRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW 100 >3i1m_N 30S ribosomal protein S14; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_N* 3e1a_G 3e1c_G 1vs5_N 3i1o_N 3i1q_N 3i1s_N 3i1z_N 3i21_N 2qal_N* 1p6g_N 1p87_N 2aw7_N 2avy_N 2i2u_N 2i2p_N* 2qan_N* 2qb9_N* 2qbb_N* 2qbd_N ... (N:46-101) Length = 56 Score = 77.7 bits (192), Expect = 6e-16 Identities = 29/56 (51%), Positives = 37/56 (66%) Query: 46 LQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 L+L +LPRD S R RNRC +GR G R F LSR+ +RE G+IPG+ K+SW Sbjct: 1 LKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 56 >2vqe_N 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} (N:) Length = 61 Score = 73.5 bits (181), Expect = 1e-14 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Query: 41 RFDAMLQLGSLPRDGSRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSS 100 R + + P+ +VR RC GR+R VYR F L R+ LREL G++PG+ K+S Sbjct: 3 RKALIEKAKRTPKF--KVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS 60 Query: 101 W 101 W Sbjct: 61 W 61 >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* (A:1-46,A:238-314,A:434-489) Length = 179 Score = 25.7 bits (56), Expect = 2.5 Identities = 9/36 (25%), Positives = 14/36 (38%) Query: 2 AKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVT 37 KV+ +E R + + R+ IV VT Sbjct: 35 YKVTVLEARTRPMDRIYYAFQDRIGTDNIVFGAEVT 70 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.136 0.377 Gapped Lambda K H 0.267 0.0747 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 752,398 Number of extensions: 30887 Number of successful extensions: 89 Number of sequences better than 10.0: 1 Number of HSP's gapped: 87 Number of HSP's successfully gapped: 7 Length of query: 101 Length of database: 4,956,049 Length adjustment: 59 Effective length of query: 42 Effective length of database: 2,961,554 Effective search space: 124385268 Effective search space used: 124385268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.0 bits)