RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} Length = 100 Score = 108 bits (271), Expect = 2e-25 Identities = 44/100 (44%), Positives = 63/100 (63%) Query: 2 AKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRVR 61 AK S R +R+ + K +KR LK I+ D + + E+R++A+L+L +LPRD S R R Sbjct: 1 AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQR 60 Query: 62 NRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 NRC +GR G R F LSR+ +RE G+IPG+ K+SW Sbjct: 61 NRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 100 >d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} Length = 60 Score = 66.2 bits (162), Expect = 7e-13 Identities = 23/46 (50%), Positives = 30/46 (65%) Query: 56 SRVRVRNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 +VR RC GR+R VYR F L R+ LREL G++PG+ K+SW Sbjct: 15 FKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 60 >d1hyoa2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 298 Score = 23.5 bits (50), Expect = 5.5 Identities = 6/20 (30%), Positives = 8/20 (40%) Query: 53 RDGSRVRVRNRCEISGRSRG 72 DG V + C+ G G Sbjct: 267 LDGDEVIITGHCQGDGYRVG 286 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.136 0.377 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 369,430 Number of extensions: 15962 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 7 Length of query: 101 Length of database: 2,407,596 Length adjustment: 62 Effective length of query: 39 Effective length of database: 1,556,336 Effective search space: 60697104 Effective search space used: 60697104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (21.9 bits)