BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780249|ref|YP_003064662.1| 50S ribosomal protein L5 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780249|ref|YP_003064662.1| 50S ribosomal protein L5 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 383 bits (984), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/185 (100%), Positives = 185/185 (100%) Query: 1 MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAA 60 MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAA Sbjct: 1 MVDCKYEPRLKKEYCLRIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKKAESAA 60 Query: 61 ADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDF 120 ADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDF Sbjct: 61 ADLALITGQKPVITRARRSIAGFKLRTGMPIGTKVTLRGTNMYDFLDRLINMGMPRIRDF 120 Query: 121 HGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFG 180 HGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFG Sbjct: 121 HGLNSRSFDGSGNFSFGIREHIVFPEINYDKVDCVLGMDISICTTTRSDREAKYLLTLFG 180 Query: 181 FPFPK 185 FPFPK Sbjct: 181 FPFPK 185 >gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Score = 25.4 bits (54), Expect = 0.65, Method: Compositional matrix adjust. Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 6/86 (6%) Query: 17 RIREAMQQEFSYKNVMQIPKIEKVVVNMGVGESIADSKK-AESAAADLALITGQKPVITR 75 ++ + + QEF + V+ P E +G+G S A K E + A+ I + Sbjct: 175 KVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAM-----QAIDQ 229 Query: 76 ARRSIAGFKLRTGMPIGTKVTLRGTN 101 S A + +G I T + RG N Sbjct: 230 IINSAAKTRYMSGGQITTSIVFRGPN 255 >gi|254780489|ref|YP_003064902.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Score = 23.5 bits (49), Expect = 2.6, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 89 MPIGTKVTLRGTNMYDFLDRLIN 111 +P G + GTN +DF R+ N Sbjct: 196 IPTGGSTSPAGTNTHDFYMRITN 218 >gi|254780317|ref|YP_003064730.1| phenylalanyl-tRNA synthetase, alpha subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 366 Score = 23.5 bits (49), Expect = 2.7, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 106 LDR--LINMGMPRIRDFHGLNSRSFDGSG 132 LDR ++ GMP +R+F G + R + G Sbjct: 324 LDRIAMLKYGMPDVREFFGADVRWIEHYG 352 >gi|254780649|ref|YP_003065062.1| nicotinic acid mononucleotide adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 216 Score = 23.1 bits (48), Expect = 3.0, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 22 MQQEFSYKNVMQIPKIE 38 MQQ S +++M++PK+E Sbjct: 1 MQQSQSLQDIMRMPKVE 17 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.140 0.410 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 114,651 Number of Sequences: 1233 Number of extensions: 4442 Number of successful extensions: 8 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 185 length of database: 328,796 effective HSP length: 69 effective length of query: 116 effective length of database: 243,719 effective search space: 28271404 effective search space used: 28271404 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 36 (18.5 bits)