RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780250|ref|YP_003064663.1| 50S ribosomal protein L24 [Candidatus Liberibacter asiaticus str. psy62] (102 letters) >d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Length = 99 Score = 95.1 bits (237), Expect = 1e-21 Identities = 48/99 (48%), Positives = 67/99 (67%), Gaps = 4/99 (4%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP--NKEAGIISKE 60 KIR D V+VL GKDKGK G+V V+ G+ V+G+N+VK+HQ+ P N+ GI+ KE Sbjct: 1 KIRRDDEVIVLTGKDKGKRGKVKNVLSS-GKVIVEGINLVKKHQKPVPALNQPGGIVEKE 59 Query: 61 ASIHLSNLSLID-KDGKQVRVGFSFVDGKKIRIAKRSGE 98 A+I +SN+++ + GK RVGF F DGKK+R K + E Sbjct: 60 AAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSE 98 >d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Length = 110 Score = 92.9 bits (231), Expect = 7e-21 Identities = 35/98 (35%), Positives = 62/98 (63%), Gaps = 2/98 (2%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTP-NKEAGIISKEA 61 + GD V+VL+GK KG+ G+V+ + + + V+GVN++ ++ + + N + G +E Sbjct: 12 HFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNVITKNVKPSMTNPQGGQEQREL 71 Query: 62 SIHLSNLSLID-KDGKQVRVGFSFVDGKKIRIAKRSGE 98 ++H S ++L+D + GK RV VDGKK+R+A SG+ Sbjct: 72 ALHASKVALVDPETGKATRVRKQIVDGKKVRVAVASGK 109 >d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Length = 101 Score = 87.5 bits (217), Expect = 3e-19 Identities = 40/96 (41%), Positives = 56/96 (58%), Gaps = 3/96 (3%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPN-KEAGIISKEA 61 ++ GD VLV +GK KG+ G+V V+ K V+GVNIVK+ R +P + G I KEA Sbjct: 5 HVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEA 64 Query: 62 SIHLSNLSLID-KDGKQVRVGFSFV-DGKKIRIAKR 95 +H S + I GK RV F+ +GKKIR+ + Sbjct: 65 PLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK 100 >d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Score = 63.6 bits (155), Expect = 5e-12 Identities = 17/81 (20%), Positives = 29/81 (35%), Gaps = 11/81 (13%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEAS 62 ++ GD V VL G G+ G+V+ V V+ V + K + Sbjct: 41 RVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEE----------VPRP 90 Query: 63 IHLSNLSLID-KDGKQVRVGF 82 + SN+ + D + R Sbjct: 91 LDTSNVRVTDLDLEDEKREAR 111 >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Score = 27.0 bits (60), Expect = 0.48 Identities = 7/30 (23%), Positives = 15/30 (50%) Query: 62 SIHLSNLSLIDKDGKQVRVGFSFVDGKKIR 91 + HL + + K+ + V++ + G IR Sbjct: 36 NTHLKAVKMTLKNREPVQLETLSIRGNNIR 65 >g1qd6.1 f.4.2.1 (A:,C:) Outer membrane phospholipase A (OMPLA) {Escherichia coli [TaxId: 562]} Length = 253 Score = 25.5 bits (56), Expect = 1.2 Identities = 9/20 (45%), Positives = 10/20 (50%), Gaps = 2/20 (10%) Query: 69 SLIDKDGKQ--VRVGFSFVD 86 SLID + Q V VG D Sbjct: 232 SLIDYNFNQTRVGVGVMLND 251 >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Score = 24.4 bits (53), Expect = 2.7 Identities = 8/30 (26%), Positives = 19/30 (63%) Query: 62 SIHLSNLSLIDKDGKQVRVGFSFVDGKKIR 91 + +SN+++ +DG+ ++ ++ G KIR Sbjct: 37 NCQMSNITVTYRDGRVAQLEQVYIRGCKIR 66 >d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]} Length = 96 Score = 23.9 bits (52), Expect = 3.7 Identities = 10/49 (20%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Query: 1 MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQG---VNIVKRHQ 46 M I G + + G++ G ++ ++ V G + VKR + Sbjct: 1 MPAIEVGRICVKVKGREAGSKCVIVDII-DDNFVLVTGPKDITGVKRRR 48 >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Score = 23.9 bits (51), Expect = 4.2 Identities = 5/17 (29%), Positives = 8/17 (47%) Query: 67 NLSLIDKDGKQVRVGFS 83 +L + + V VG S Sbjct: 194 DLKQEFPNSEWVNVGLS 210 >d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Score = 23.8 bits (52), Expect = 4.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 4 IRTGDRVLVLAGKDKGKAGQVMGV 27 + GD V V+AG+ +G G ++ V Sbjct: 11 FKMGDHVKVIAGRFEGDTGLIVRV 34 >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Length = 172 Score = 23.8 bits (50), Expect = 4.4 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Query: 63 IHLSNLSLIDKDGKQVRV--GFSFVDGKKI 90 IH S+ L+ DGK ++ G I Sbjct: 132 IHQSSFYLVGPDGKVLKDYNGVENTPYDDI 161 >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Score = 23.7 bits (50), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 40 NIVKRHQRQTPNKEA 54 N V RH +TPNK+A Sbjct: 63 NCVDRHALKTPNKKA 77 >d1xdna_ d.142.2.4 (A:) RNA editing ligase MP52 {Trypanosoma brucei [TaxId: 5691]} Length = 265 Score = 23.0 bits (49), Expect = 8.0 Identities = 9/35 (25%), Positives = 15/35 (42%), Gaps = 9/35 (25%) Query: 63 IHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSG 97 +H +N + + D + +R AKRSG Sbjct: 37 VHGTNFGIYLINQG---------DHEVVRFAKRSG 62 >d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Length = 270 Score = 22.7 bits (48), Expect = 8.7 Identities = 7/32 (21%), Positives = 12/32 (37%), Gaps = 9/32 (28%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRA 34 + GD+V KAG + +G + Sbjct: 221 TVSAGDKV---------KAGDQIAYSGSTGNS 243 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.137 0.373 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 363,612 Number of extensions: 15075 Number of successful extensions: 75 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 24 Length of query: 102 Length of database: 2,407,596 Length adjustment: 63 Effective length of query: 39 Effective length of database: 1,542,606 Effective search space: 60161634 Effective search space used: 60161634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.0 bits)