BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780250|ref|YP_003064663.1| 50S ribosomal protein L24 [Candidatus Liberibacter asiaticus str. psy62] (102 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780250|ref|YP_003064663.1| 50S ribosomal protein L24 [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Score = 200 bits (508), Expect = 6e-54, Method: Compositional matrix adjust. Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKE 60 MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKE Sbjct: 1 MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKE 60 Query: 61 ASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG 102 ASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG Sbjct: 61 ASIHLSNLSLIDKDGKQVRVGFSFVDGKKIRIAKRSGEPIDG 102 >gi|254780932|ref|YP_003065345.1| hypothetical protein CLIBASIA_04155 [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Score = 21.6 bits (44), Expect = 3.5, Method: Compositional matrix adjust. Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Query: 27 VVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISKEASIH---LSNLSLIDKDGKQVRVGFS 83 ++ + + F N+ Q Q P ++ G+I KE + +SN D++ + G Sbjct: 22 ILENNDQEFSTSNNV----QTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVE 77 Query: 84 F 84 + Sbjct: 78 Y 78 >gi|254781114|ref|YP_003065527.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 263 Score = 21.2 bits (43), Expect = 4.4, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 49 TPNKEAGIISKEASIHLSNL 68 +P I KEA+IHL N+ Sbjct: 149 SPRTTGYFIGKEAAIHLLNV 168 >gi|254780641|ref|YP_003065054.1| hypothetical protein CLIBASIA_02640 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 20.8 bits (42), Expect = 5.8, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 77 QVRVGFSFVDGKKIRIAKRSGE 98 Q+ F+DG+K IA++ E Sbjct: 2 QISAKIEFLDGQKYTIARQMHE 23 >gi|254780801|ref|YP_003065214.1| hypothetical protein CLIBASIA_03460 [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 20.8 bits (42), Expect = 6.0, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 85 VDGKKIRIAKRSGEPI 100 VD KKIR+A G+ I Sbjct: 37 VDSKKIRVALSCGQVI 52 >gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 20.0 bits (40), Expect = 9.4, Method: Compositional matrix adjust. Identities = 7/29 (24%), Positives = 17/29 (58%) Query: 12 VLAGKDKGKAGQVMGVVRKSGRAFVQGVN 40 ++ G + K G+ +G+ + + + +GVN Sbjct: 24 MILGMSQEKLGECLGITFQQVQKYEKGVN 52 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.137 0.373 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,743 Number of Sequences: 1233 Number of extensions: 2333 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 102 length of database: 328,796 effective HSP length: 62 effective length of query: 40 effective length of database: 252,350 effective search space: 10094000 effective search space used: 10094000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 32 (16.9 bits)