RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780252|ref|YP_003064665.1| 30S ribosomal protein S17 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >2vqe_Q 30S ribosomal protein S17; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} (Q:) Length = 105 Score = 86.0 bits (213), Expect = 1e-18 Identities = 44/75 (58%), Positives = 56/75 (74%) Query: 1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60 MPK+VL G+VVSDK +KT+ VLVER+F HP + K I+RSK+Y HD KYK+GD V I Sbjct: 1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEII 60 Query: 61 ESAPISKKKSWLVID 75 ES PISK+K + V+ Sbjct: 61 ESRPISKRKRFRVLR 75 >3i1m_Q 30S ribosomal protein S17; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_Q* 3e1a_J 3e1c_J 1vs5_Q 3i1o_Q 3i1q_Q 3i1s_Q 3i1z_Q 3i21_Q 2qal_Q* 1p6g_Q 1p87_Q 2aw7_Q 2avy_Q 2i2u_Q 2i2p_Q* 2qan_Q* 2qb9_Q* 2qbb_Q* 2qbd_Q ... (Q:) Length = 84 Score = 80.5 bits (199), Expect = 6e-17 Identities = 37/73 (50%), Positives = 49/73 (67%) Query: 3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEES 62 R LQG VVSDK EK+I+V +ER HP + K I+R+ + VHDENN+ +GD V I E Sbjct: 5 IRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIREC 64 Query: 63 APISKKKSWLVID 75 P+SK KSW ++ Sbjct: 65 RPLSKTKSWTLVR 77 >1qd7_I S17 ribosomal protein; 30S ribosomal subunit, low resolution model, ribosome; 5.50A {Thermus thermophilus} (I:) Length = 89 Score = 80.6 bits (199), Expect = 6e-17 Identities = 34/73 (46%), Positives = 49/73 (67%) Query: 3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEES 62 ++V G VVSDK +KTI VLVE HP + K ++ SK+Y HDE+N+ KVGD V I E+ Sbjct: 2 RKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDIVKIMET 61 Query: 63 APISKKKSWLVID 75 P+S K + +++ Sbjct: 62 RPLSATKRFRLVE 74 >3bbn_Q Ribosomal protein S17; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} (Q:) Length = 142 Score = 77.2 bits (190), Expect = 8e-16 Identities = 31/73 (42%), Positives = 49/73 (67%) Query: 3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEES 62 + +QG VV S+KT+ V V R HP++++ +R K+Y HD +N++KVGD V +E+S Sbjct: 60 MKTMQGRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKVGDVVRLEKS 119 Query: 63 APISKKKSWLVID 75 PISK KS++ + Sbjct: 120 RPISKTKSFVALP 132 >2zkq_q 40S ribosomal protein S11E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 1s1h_Q (q:) Length = 158 Score = 76.5 bits (188), Expect = 1e-15 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Query: 1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDEN--NKYKVGDFVS 58 + R+L G+V K ++TI++ + ++ + +R K +VH ++GD V+ Sbjct: 68 IRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVT 127 Query: 59 IEESAPISKKKSWLVI 74 + E P+SK + V+ Sbjct: 128 VGECRPLSKTVRFNVL 143 >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} (A:1-126,A:276-340) Length = 191 Score = 26.2 bits (57), Expect = 1.5 Identities = 4/30 (13%), Positives = 9/30 (30%) Query: 42 YAVHDENNKYKVGDFVSIEESAPISKKKSW 71 Y + + D + +A + W Sbjct: 102 YVKTSADFVVPIPDSIDDFTAAQMYSPYKW 131 >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA; 2.30A {Thermus thermophilus HB8} (A:1-148,A:294-343) Length = 198 Score = 25.6 bits (55), Expect = 2.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 42 YAVHDENNKYKVGDFVSIEESAPISKKKSWLVID 75 Y V E N +S EE+A I K + + ++ Sbjct: 124 YVVLPEANLAPKPKNLSFEEAAAIPKSRLFPILR 157 >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, fatty acid synthesis (type 2), structural genomics; 1.75A {Homo sapiens} PDB: 2vcy_A (A:1-149,A:305-357) Length = 202 Score = 25.0 bits (54), Expect = 3.4 Identities = 6/34 (17%), Positives = 14/34 (41%) Query: 42 YAVHDENNKYKVGDFVSIEESAPISKKKSWLVID 75 AV E +V + ++ +A + + +I Sbjct: 125 EAVFSEEALIQVPSDIPLQSAATLGPDQFKELIL 158 >3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 1v0e_A 1v0f_A* (A:141-281) Length = 141 Score = 25.0 bits (54), Expect = 3.5 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query: 26 RFSHPRFQKTIRRSKRYA-VHDENNKYKVGDFVSIEESA 63 R H T ++RYA +H ++ VGDFV+ SA Sbjct: 45 RSLHLTGGITKAANQRYATIHVPDHGLFVGDFVNFSNSA 83 >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} (A:1-166,A:318-371) Length = 220 Score = 24.8 bits (53), Expect = 4.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 42 YAVHDENNKYKVGDFVSIEESAP 64 YA+ ENN KV V IE +P Sbjct: 148 YALSRENNTVKVTKDVPIESGSP 170 >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} (A:1-166,A:310-359) Length = 216 Score = 24.4 bits (52), Expect = 5.2 Identities = 3/25 (12%), Positives = 10/25 (40%) Query: 42 YAVHDENNKYKVGDFVSIEESAPIS 66 + + K+ +S E+ ++ Sbjct: 140 FMRTSHRSVIKLPKDISREKLVEMA 164 >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural genomics, JCSG, PSI, protein structure initiative; 2.00A {Thermotoga maritima} (A:41-178,A:327-380) Length = 192 Score = 24.0 bits (51), Expect = 7.8 Identities = 5/27 (18%), Positives = 10/27 (37%) Query: 39 SKRYAVHDENNKYKVGDFVSIEESAPI 65 S + E + KV + ++ A Sbjct: 110 SSHIVLDPETDVLKVSEKDDLDVLAMA 136 >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinone reduction, structural genomics, structural genomics consortium, SGC; HET: NAP; 1.85A {Homo sapiens} (A:1-153,A:319-351) Length = 186 Score = 23.9 bits (51), Expect = 8.2 Identities = 6/24 (25%), Positives = 14/24 (58%) Query: 42 YAVHDENNKYKVGDFVSIEESAPI 65 YA+ ++ YK+ + + ++ A I Sbjct: 128 YALAADHTVYKLPEKLDFKQGAAI 151 >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* (A:352-551) Length = 200 Score = 23.9 bits (51), Expect = 8.3 Identities = 7/32 (21%), Positives = 18/32 (56%) Query: 8 GMVVSDKSEKTIIVLVERRFSHPRFQKTIRRS 39 G + D ++K + L+++RF ++K ++ Sbjct: 162 GRAIRDVNDKCNVWLLDKRFESLYWKKNLKCL 193 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.132 0.368 Gapped Lambda K H 0.267 0.0552 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 561,414 Number of extensions: 20056 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 19 Length of query: 79 Length of database: 4,956,049 Length adjustment: 44 Effective length of query: 35 Effective length of database: 3,468,629 Effective search space: 121402015 Effective search space used: 121402015 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)