RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780252|ref|YP_003064665.1| 30S ribosomal protein S17 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) >d2uubq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} Length = 100 Score = 93.6 bits (233), Expect = 4e-21 Identities = 43/74 (58%), Positives = 55/74 (74%) Query: 2 PKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEE 61 PK+VL G+VVSDK +KT+ VLVER+F HP + K I+RSK+Y HD KYK+GD V I E Sbjct: 1 PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIE 60 Query: 62 SAPISKKKSWLVID 75 S PISK+K + V+ Sbjct: 61 SRPISKRKRFRVLR 74 >d2gy9q1 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} Length = 78 Score = 85.1 bits (211), Expect = 2e-18 Identities = 37/72 (51%), Positives = 49/72 (68%) Query: 4 RVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESA 63 R LQG VVSDK EK+I+V +ER HP + K I+R+ + VHDENN+ +GD V I E Sbjct: 1 RTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECR 60 Query: 64 PISKKKSWLVID 75 P+SK KSW ++ Sbjct: 61 PLSKTKSWTLVR 72 >d1ripa_ b.40.4.5 (A:) Ribosomal protein S17 {Bacillus stearothermophilus [TaxId: 1422]} Length = 81 Score = 85.1 bits (211), Expect = 2e-18 Identities = 34/73 (46%), Positives = 49/73 (67%) Query: 3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEES 62 ++V G VVSDK +KTI VLVE HP + K ++ SK+Y HDE+N+ KVGD V I E+ Sbjct: 2 RKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDIVKIMET 61 Query: 63 APISKKKSWLVID 75 P+S K + +++ Sbjct: 62 RPLSATKRFRLVE 74 >d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 271 Score = 25.8 bits (56), Expect = 1.2 Identities = 6/20 (30%), Positives = 8/20 (40%) Query: 28 SHPRFQKTIRRSKRYAVHDE 47 HP F K + Y V + Sbjct: 243 QHPAFIKGWEGLELYGVELD 262 >d1kica_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]} Length = 327 Score = 23.9 bits (51), Expect = 3.9 Identities = 9/36 (25%), Positives = 13/36 (36%) Query: 7 QGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRY 42 +G V +E + V R F + RS R Sbjct: 291 EGATVRTDAENYPLTFVARNPEAEFFLDMLLRSARA 326 >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Score = 23.7 bits (50), Expect = 4.5 Identities = 5/27 (18%), Positives = 11/27 (40%) Query: 40 KRYAVHDENNKYKVGDFVSIEESAPIS 66 +Y V ++ K+ V ++E Sbjct: 148 SQYTVVNQIAVAKIDPSVKLDEFITHR 174 >d1twfb_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 1207 Score = 23.3 bits (49), Expect = 6.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 60 EESAPISKKKSWLVIDS 76 +ESAPI+ + SW VI + Sbjct: 3 DESAPITAEDSWAVISA 19 >d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 240 Score = 23.1 bits (49), Expect = 6.8 Identities = 8/34 (23%), Positives = 14/34 (41%) Query: 27 FSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60 + HP K I + R+A + G+ +E Sbjct: 203 YHHPDVLKVIANAVRWAAPVNRGEIVFGNVKPLE 236 >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Score = 22.9 bits (48), Expect = 7.0 Identities = 6/24 (25%), Positives = 9/24 (37%) Query: 42 YAVHDENNKYKVGDFVSIEESAPI 65 Y V E N +V D ++ Sbjct: 153 YTVVSEANLARVDDEFDLDLLVTH 176 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.132 0.368 Gapped Lambda K H 0.267 0.0675 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 278,139 Number of extensions: 10075 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 14 Length of query: 79 Length of database: 2,407,596 Length adjustment: 45 Effective length of query: 34 Effective length of database: 1,789,746 Effective search space: 60851364 Effective search space used: 60851364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.0 bits)