BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780252|ref|YP_003064665.1| 30S ribosomal protein S17 [Candidatus Liberibacter asiaticus str. psy62] (79 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780252|ref|YP_003064665.1| 30S ribosomal protein S17 [Candidatus Liberibacter asiaticus str. psy62] Length = 79 Score = 160 bits (405), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 79/79 (100%), Positives = 79/79 (100%) Query: 1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE Sbjct: 1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60 Query: 61 ESAPISKKKSWLVIDSEGV 79 ESAPISKKKSWLVIDSEGV Sbjct: 61 ESAPISKKKSWLVIDSEGV 79 >gi|254780591|ref|YP_003065004.1| aminomethyltransferase protein (glycine cleavage) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 22.3 bits (46), Expect = 1.7, Method: Compositional matrix adjust. Identities = 15/60 (25%), Positives = 28/60 (46%) Query: 1 MPKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIE 60 +P ++ +G + K ++ + + F I RSKR ++ D+ YK+ V IE Sbjct: 34 LPYKIARGSAILTPQGKILLYFLISKIEEDTFILEIDRSKRDSLIDKLLFYKLRSNVIIE 93 >gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 358 Score = 21.9 bits (45), Expect = 2.1, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 26/67 (38%), Gaps = 9/67 (13%) Query: 5 VLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAP 64 +L ++ S +I +E R H R RYA+ K ++G F + Sbjct: 266 LLDALIPKSYSHTELIRFIEDRPGHDR---------RYAIDSSKIKSEIGWFPQENMESG 316 Query: 65 ISKKKSW 71 ++K W Sbjct: 317 LNKTVCW 323 >gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Score = 21.9 bits (45), Expect = 2.2, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 5 VLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRS 39 ++QG ++ E T L+ F HP +T++ S Sbjct: 436 LIQGFSIAMSLETTEEELMHTVFPHPTISETMKES 470 >gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62] Length = 707 Score = 21.6 bits (44), Expect = 2.8, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 14/25 (56%) Query: 13 DKSEKTIIVLVERRFSHPRFQKTIR 37 DK KTII+ VE R + TIR Sbjct: 671 DKEGKTIIINVEDVNRDERMESTIR 695 >gi|254780919|ref|YP_003065332.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter asiaticus str. psy62] Length = 198 Score = 21.2 bits (43), Expect = 3.9, Method: Compositional matrix adjust. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 51 YKVGDFVSIEESAPISKKK-----SWLVIDS 76 YKV DF S+E + ++ + +W ++D+ Sbjct: 127 YKVTDFYSVEHDSGVAWQDKSIDITWPLLDT 157 >gi|254780897|ref|YP_003065310.1| trigger factor [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 20.8 bits (42), Expect = 4.1, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 17/35 (48%) Query: 3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIR 37 +RVL G+V+ EK I + E +Q+ R Sbjct: 356 RRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGR 390 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 20.4 bits (41), Expect = 5.6, Method: Compositional matrix adjust. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 31 RFQKTIRRSKRYAVHDENNKYKVGDFVSIEE 61 + + TIR HD N+ + D ++E+ Sbjct: 685 KLRNTIRWMLGMLAHDTGNEPSLADMPALEQ 715 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 20.4 bits (41), Expect = 5.9, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 37 RRSKRYAVHDENNKYKVGDFVSIEESAPISKKKS 70 R SK+ + +DE N D EE +KK+S Sbjct: 252 RWSKQGSTYDEENFNYKWDTFDFEEIGDTAKKRS 285 >gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62] Length = 779 Score = 20.0 bits (40), Expect = 7.0, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 7/32 (21%) Query: 33 QKTIRR-------SKRYAVHDENNKYKVGDFV 57 Q IRR +K + V D NNK + D+V Sbjct: 495 QDNIRRHDLQIIATKDFDVIDLNNKQSLKDYV 526 >gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 20.0 bits (40), Expect = 8.4, Method: Compositional matrix adjust. Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 16 EKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKS 70 +KT++ RR + +KR +H N G+F S + S +S+K++ Sbjct: 38 DKTMVADAMRRIRSEAGKHRKNAAKRMLIHQRENTASKGEFQS-QSSISMSEKQT 91 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.132 0.368 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,710 Number of Sequences: 1233 Number of extensions: 1686 Number of successful extensions: 16 Number of sequences better than 100.0: 16 Number of HSP's better than 100.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of query: 79 length of database: 328,796 effective HSP length: 49 effective length of query: 30 effective length of database: 268,379 effective search space: 8051370 effective search space used: 8051370 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 31 (16.5 bits)