HHsearch alignment for GI: 254780254 and conserved domain: PRK04199

>PRK04199 rpl10e 50S ribosomal protein L10e; Reviewed.
Probab=99.76  E-value=4.7e-18  Score=123.81  Aligned_cols=102  Identities=25%  Similarity=0.331  Sum_probs=90.0

Q ss_pred             CEEECCCEEECHHHHHHHHHHHHHHCCC-----CCEEEEEECCCCEEEEECCCC---------CCCCCCCCCCEEEEEEC
Q ss_conf             3274053132599999999999974267-----846898754986078621544---------00144788110699832
Q gi|254780254|r   34 ALKAQEANRIGSSEIEAARRAISRGMKR-----AGRVWICVFPDVPVTAKPTEV---------RMGKGKGNVEKWVCRVK   99 (138)
Q Consensus        34 GL~a~e~g~it~~qiEaaR~~i~R~lkk-----~gkiwirv~P~~pvTkKp~e~---------RMGkGKG~~~~wv~~Vk   99 (138)
T Consensus        48 ~Lv~~e~~QIr~~ALEAaRi~aNkyl~k~~G~~~y~~rir~yPhhVlReNKm~s~AGADRlq~GMR~aFGKp~G~aARV~  127 (173)
T PRK04199         48 SLVVKEPCQIRHNALEAARIAANKYLTKTVGRSNYYLKIRVYPHHVLRENKMATGAGADRVSDGMRLAFGKPVGTAARVE  127 (173)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEEECHHHCCCCHHHHHCCCCCCCCCCCEEEEEEC
T ss_conf             99865511220889999999999999985275662699984364025641222022134552034333578650599965


Q ss_pred             CCEEEEEECCCCH--HHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             1508999749799--99999999985438951799998
Q gi|254780254|r  100 PGRILFEIDGVSE--EVARRAFRLGAAKLSVVTKFIQR  135 (138)
Q Consensus       100 ~G~ilfEi~gi~~--~~a~~al~~a~~KLP~k~k~i~k  135 (138)
T Consensus       128 ~Gq~i~si~~~~~~~~~akeALrrA~~KlP~~~kI~v~  165 (173)
T PRK04199        128 PGQKIFTVRVNPEHLEAAKEALRRAAMKLPTPCRIVVE  165 (173)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             99989999976571899999999741538997799996